Mouse anti-Human PLG Monoclonal Antibody | anti-PLG antibody

PLG (Plasminogen, DKFZp779M0222) (MaxLight 490)

Cat. Num. AAA6202546

• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PLG; Monoclonal Antibody; PLG (Plasminogen; DKFZp779M0222) (MaxLight 490); anti-PLG antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2A10
• Specificity: Recognizes human PLG.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

• Applicable Applications for anti-PLG antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa21-120 from human PLG (AAH60513) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKN
• Conjugate: MaxLight490
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-PLG antibody

Plasminogen is a key proenzyme of plasmin in the fibrinolytic and thrombolytic systems, the deficiency of which leads to a mild thrombotic tendency. Plasminogen binds to fibrin as well as to the surface of endothelial cells and monocytes/macrophages, where it is activated to plasmin. Streptokinase is a plasminogen activator widely used in treating blood-clotting disorders. Complexes of streptokinase with human plasminogen can hydrolytically activate other plasminogen molecules to plasmin, which then dissolves blood clots. Apolipoprotein(a) is very similar to plasminogen in terms of aa sequence, it inhibits plasmin generation by competing with plasminogen's binding to fibrin and endothelial cells. This antibody recognizes plasminogen and plasmin but not HGF1/MSP or HGF/SF.

Product Categories/Family for anti-PLG antibody

Antibodies; Coagulation Factors

NCBI and Uniprot Product Information

• NCBI GI #: 38051822
• NCBI GeneID: 5340
• UniProt Accession #: P00747; Q15146; Q5TEH4; Q6PA00
• Molecular Weight: Calculated Molecular Weight: 810aa; 91kDa; Observed Molecular Weight: 105kDa
• NCBI Official Full Name: Homo sapiens plasminogen, mRNA
• NCBI Official Synonym Full Names: plasminogen
• NCBI Official Symbol: PLG
• NCBI Protein Information: plasminogen
• UniProt Protein Name: Plasminogen
• Protein Family: Plasminogen
• UniProt Gene Name: PLG
• UniProt Entry Name: PLMN_HUMAN

NCBI Description

The protein encoded by this gene is a secreted blood zymogen that is activated by proteolysis and converted to plasmin and angiostatin. Plasmin dissolves fibrin in blood clots and is an important protease in many other cellular processes while angiostatin inhibits angiogenesis. Defects in this gene are likely a cause of thrombophilia and ligneous conjunctivitis. Two transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Dec 2009]

Uniprot Description

Plasminogen: Plasmin dissolves the fibrin of blood clots and acts as a proteolytic factor in a variety of other processes including embryonic development, tissue remodeling, tumor invasion, and inflammation. In ovulation, weakens the walls of the Graafian follicle. It activates the urokinase-type plasminogen activator, collagenases and several complement zymogens, such as C1 and C5. Cleavage of fibronectin and laminin leads to cell detachment and apoptosis. Also cleaves fibrin, thrombospondin and von Willebrand factor. Its role in tissue remodeling and tumor invasion may be modulated by CSPG4. Binds to cells. Defects in PLG are the cause of plasminogen deficiency (PLGD). PLGD is characterized by decreased serum plasminogen activity. Two forms of the disorder are distinguished: type 1 deficiency is additionally characterized by decreased plasminogen antigen levels and clinical symptoms, whereas type 2 deficiency, also known as dysplasminogenemia, is characterized by normal, or slightly reduced antigen levels, and absence of clinical manifestations. Plasminogen deficiency type 1 results in markedly impaired extracellular fibrinolysis and chronic mucosal pseudomembranous lesions due to subepithelial fibrin deposition and inflammation. The most common clinical manifestation of type 1 deficiency is ligneous conjunctivitis in which pseudomembranes formation on the palpebral surfaces of the eye progresses to white, yellow-white, or red thick masses with a wood-like consistency that replace the normal mucosa. Belongs to the peptidase S1 family. Plasminogen subfamily.

Protein type: Secreted; Secreted, signal peptide; Protease; Motility/polarity/chemotaxis; EC 3.4.21.7

Chromosomal Location of Human Ortholog: 6q26

Cellular Component: extracellular space; cell surface; extrinsic to external side of plasma membrane; extracellular region; plasma membrane

Molecular Function: protein domain specific binding; protein binding; serine-type peptidase activity; serine-type endopeptidase activity; apolipoprotein binding; receptor binding

Biological Process: platelet activation; extracellular matrix organization and biogenesis; tissue remodeling; myoblast differentiation; muscle maintenance; negative regulation of cell proliferation; extracellular matrix disassembly; fibrinolysis; platelet degranulation; cellular protein metabolic process; negative regulation of fibrinolysis; proteolysis involved in cellular protein catabolic process; tissue regeneration; positive regulation of fibrinolysis; blood coagulation; transmembrane transport

Disease: Plasminogen Deficiency, Type I