Cystathionine beta-synthase (CBS) Recombinant Protein | CBS recombinant protein

Recombinant Human Cystathionine beta-synthase (CBS), partial

Cat. Num. AAA7110828

• Gene Names: CBS; HIP4
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Cystathionine beta-synthase (CBS); Recombinant Human Cystathionine beta-synthase (CBS); partial; Beta-thionase; Serine sulfhydrase; CBS recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-413. Partial-length
• Sequence: MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLR

• Organism: Homo sapiens (Human)
• Tag Information: N-terminal 6xHis-SUMO-tagged
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.; Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C.; The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-Page

Related Product Information for CBS recombinant protein

Only known pyridoxal phosphate-dependent enzyme that contains he. Important regulator of hydrogen sulfide, especially in the brain, utilizing cysteine instead of serine to catalyze the formation of hydrogen sulfide. Hydrogen sulfide is a gastratransmitter with signaling and cytoprotective effects such as acting as a neuromodulator in the brain to protect neurons against hypoxic injury.

Product Categories/Family for CBS recombinant protein

Metabolism

References

Human cystathionine beta-synthase cDNA sequence, alternative splicing and expression in cultured cells.Kraus J.P., Le K., Swaroop M., Ohura T., Tahara T., Rosenberg L.E., Roper M.D., Kozich V.Hum. Mol. Genet. 2:1633-1638 (1993)

NCBI and Uniprot Product Information

• NCBI GI #: 4557415
• NCBI GeneID: 875
• NCBI Accession #: NP_000062.1
• NCBI GenBank Nucleotide #: NM_000071.2
• UniProt Accession #: P35520; Q99425; Q9BWC5; B2R993; D3DSK4
• Molecular Weight: 47.4 kDa
• NCBI Official Full Name: cystathionine beta-synthase isoform 1
• NCBI Official Synonym Full Names: cystathionine-beta-synthase
• NCBI Official Symbol: CBS
• NCBI Official Synonym Symbols: HIP4
• NCBI Protein Information: cystathionine beta-synthase
• UniProt Protein Name: Cystathionine beta-synthase
• Protein Family: Cystathionine beta-synthase
• UniProt Gene Name: CBS

NCBI Description

The protein encoded by this gene acts as a homotetramer to catalyze the conversion of homocysteine to cystathionine, the first step in the transsulfuration pathway. The encoded protein is allosterically activated by adenosyl-methionine and uses pyridoxal phosphate as a cofactor. Defects in this gene can cause cystathionine beta-synthase deficiency (CBSD), which can lead to homocystinuria. This gene is a major contributor to cellular hydrogen sulfide production. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Feb 2016]

Uniprot Description

Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group of L-serine is displaced by L-homocysteine in a beta-replacement reaction to form L-cystathionine, the precursor of L-cysteine. This catabolic route allows the elimination of L-methionine and the toxic metabolite L-homocysteine (PubMed:23981774, PubMed:20506325, PubMed:23974653). Also involved in the production of hydrogen sulfide, a gasotransmitter with signaling and cytoprotective effects on neurons ().