Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged FGF1 is ~10ng/ml using as a capture antibody.)

Mouse anti-Human FGF1 Monoclonal Antibody | anti-FGF1 antibody

FGF1 (Fibroblast Growth Factor 1, FGF-1, Acidic Fibroblast Growth Factor, aFGF, Beta-endothelial Cell Growth Factor, ECGF-beta, Heparin-binding Growth Factor 1, HBGF-1, FGFA) (MaxLight 490)

Gene Names
FGF1; AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha
Reactivity
Human
Applications
Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FGF1; Monoclonal Antibody; FGF1 (Fibroblast Growth Factor 1; FGF-1; Acidic Fibroblast Growth Factor; aFGF; Beta-endothelial Cell Growth Factor; ECGF-beta; Heparin-binding Growth Factor 1; HBGF-1; FGFA) (MaxLight 490); anti-FGF1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2E12
Specificity
Recognizes human FGF1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-FGF1 antibody
FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa46-155 from human FGF1 (AAH32697) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged FGF1 is ~10ng/ml using as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FGF1 is ~10ng/ml using as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of FGF1 expression in transfected 293T cell line using. Lane 1: transfected lysate (17.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FGF1 expression in transfected 293T cell line using. Lane 1: transfected lysate (17.5kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of FGF1 transfected lysate using and Protein A Magnetic Bead and immunoblotted with FGF1 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of FGF1 transfected lysate using and Protein A Magnetic Bead and immunoblotted with FGF1 rabbit polyclonal antibody.)

Immunohistochemistry (IHC)

(Immunohistochemistry of formalin-fixed paraffin-embedded human tonsil using 1 (3ug/ml) and Immunoperoxidase.)

Immunohistochemistry (IHC) (Immunohistochemistry of formalin-fixed paraffin-embedded human tonsil using 1 (3ug/ml) and Immunoperoxidase.)
Product Categories/Family for anti-FGF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
6,698 Da
NCBI Official Full Name
Homo sapiens fibroblast growth factor 1 (acidic), mRNA
NCBI Official Synonym Full Names
fibroblast growth factor 1
NCBI Official Symbol
FGF1
NCBI Official Synonym Symbols
AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha
NCBI Protein Information
fibroblast growth factor 1
Protein Family

NCBI Description

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq, Jan 2009]

Research Articles on FGF1

Similar Products

Product Notes

The FGF1 (Catalog #AAA6200821) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FGF1 (Fibroblast Growth Factor 1, FGF-1, Acidic Fibroblast Growth Factor, aFGF, Beta-endothelial Cell Growth Factor, ECGF-beta, Heparin-binding Growth Factor 1, HBGF-1, FGFA) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FGF1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FGF1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FGF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.