Mouse anti-Human FGF1 Monoclonal Antibody | anti-FGF1 antibody

FGF1 (Fibroblast Growth Factor 1, FGF-1, Acidic Fibroblast Growth Factor, aFGF, Beta-endothelial Cell Growth Factor, ECGF-beta, Heparin-binding Growth Factor 1, HBGF-1, FGFA) (FITC)

Cat. Num. AAA6147192

• Gene Names: FGF1; AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: FGF1; Monoclonal Antibody; FGF1 (Fibroblast Growth Factor 1; FGF-1; Acidic Fibroblast Growth Factor; aFGF; Beta-endothelial Cell Growth Factor; ECGF-beta; Heparin-binding Growth Factor 1; HBGF-1; FGFA) (FITC); anti-FGF1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2E12
• Specificity: Recognizes human FGF1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-FGF1 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa46-155 from human FGF1 (AAH32697) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged FGF1 is ~10ng/ml using 126766 as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of FGF1 expression in transfected 293T cell line using 126766. Lane 1: transfected lysate (17.5kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of FGF1 transfected lysate using 126766 and Protein A Magnetic Bead and immunoblotted with FGF1 rabbit polyclonal antibody.)

Immunohistochemistry (IHC)

(Immunohistochemistry of formalin-fixed paraffin-embedded human tonsil using 1267661 (3ug/ml) and Immunoperoxidase.)

Immunofluorescence (IF)

(Immunofluorescence of HeLa cells using 126766 (10ug/ml).)

Testing Data

()

Product Categories/Family for anti-FGF1 antibody

Antibodies; Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 21595686
• NCBI GeneID: 2246
• Molecular Weight: 6,698 Da
• NCBI Official Full Name: Homo sapiens fibroblast growth factor 1 (acidic), mRNA
• NCBI Official Synonym Full Names: fibroblast growth factor 1
• NCBI Official Symbol: FGF1
• NCBI Official Synonym Symbols: AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha
• NCBI Protein Information: fibroblast growth factor 1
• Protein Family: Fibroblast growth factor

NCBI Description

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq, Jan 2009]