Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged MAMLD1 is 0.3 ng/ml as a capture antibody.)

Mouse MAMLD1 Monoclonal Antibody | anti-MAMLD1 antibody

MAMLD1 (Mastermind-like Domain Containing 1, CG1, CXorf6, F18) (PE)

Gene Names
MAMLD1; CG1; F18; HYSP2; CXorf6
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
MAMLD1; Monoclonal Antibody; MAMLD1 (Mastermind-like Domain Containing 1; CG1; CXorf6; F18) (PE); Mastermind-like Domain Containing 1; F18; anti-MAMLD1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4B4
Specificity
Recognizes MAMLD1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-MAMLD1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
MAMLD1 (NP_005482, 603aa-701aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SPSNITHVDKACKLGEARHPQVSLGRQPPSCQALGSESFLPGSSFAHELARVTSSYSTSEAAPWGSWDPKAWRQVPAPLLPSCDATARGTEIRSYGNDP
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged MAMLD1 is 0.3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MAMLD1 is 0.3 ng/ml as a capture antibody.)
Related Product Information for anti-MAMLD1 antibody
Mouse monoclonal antibody raised against a partial recombinant MAMLD1.
Product Categories/Family for anti-MAMLD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74kDa
NCBI Official Full Name
mastermind-like domain-containing protein 1 isoform 3
NCBI Official Synonym Full Names
mastermind like domain containing 1
NCBI Official Symbol
MAMLD1
NCBI Official Synonym Symbols
CG1; F18; HYSP2; CXorf6
NCBI Protein Information
mastermind-like domain-containing protein 1
UniProt Protein Name
Mastermind-like domain-containing protein 1
UniProt Gene Name
MAMLD1
UniProt Synonym Gene Names
CG1; CXorf6
UniProt Entry Name
MAMD1_HUMAN

NCBI Description

This gene encodes a mastermind-like domain containing protein. This protein may function as a transcriptional co-activator. Mutations in this gene are the cause of X-linked hypospadias type 2. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Apr 2010]

Uniprot Description

MAMLD1: Transactivates the HES3 promoter independently of NOTCH proteins. HES3 is a non-canonical NOTCH target gene which lacks binding sites for RBPJ. Defects in MAMLD1 are a cause of X-linked hypospadias type 2 (HYSP2). Hypospadias is a common malformation in which the urethra opens on the ventral side of the penis. It is considered a complex disorder with both genetic and environmental factors involved in the pathogenesis. Hypospadias can occur alone on an apparently multifactorial basis or as part of syndromes. Belongs to the mastermind family. 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: nucleus

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription, DNA-dependent; male gonad development

Disease: Hypospadias 2, X-linked

Research Articles on MAMLD1

Similar Products

Product Notes

The MAMLD1 mamld1 (Catalog #AAA6187945) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MAMLD1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAMLD1 mamld1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAMLD1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.