Mouse MAMLD1 Monoclonal Antibody | anti-MAMLD1 antibody

MAMLD1 (Mastermind-like Domain Containing 1, CG1, CXorf6, F18) (FITC)

Cat. Num. AAA6179125

• Gene Names: MAMLD1; CG1; F18; HYSP2; CXorf6
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: MAMLD1; Monoclonal Antibody; MAMLD1 (Mastermind-like Domain Containing 1; CG1; CXorf6; F18) (FITC); Mastermind-like Domain Containing 1; F18; anti-MAMLD1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4B4
• Specificity: Recognizes MAMLD1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-MAMLD1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: MAMLD1 (NP_005482, 603aa-701aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SPSNITHVDKACKLGEARHPQVSLGRQPPSCQALGSESFLPGSSFAHELARVTSSYSTSEAAPWGSWDPKAWRQVPAPLLPSCDATARGTEIRSYGNDP
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged MAMLD1 is 0.3 ng/ml as a capture antibody.)

Related Product Information for anti-MAMLD1 antibody

Mouse monoclonal antibody raised against a partial recombinant MAMLD1.

Product Categories/Family for anti-MAMLD1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 294489310
• NCBI GeneID: 10046
• NCBI Accession #: NP_005482
• NCBI GenBank Nucleotide #: NM_005491
• UniProt Accession #: Q13495
• Molecular Weight: 74kDa
• NCBI Official Full Name: mastermind-like domain-containing protein 1 isoform 3
• NCBI Official Synonym Full Names: mastermind like domain containing 1
• NCBI Official Symbol: MAMLD1
• NCBI Official Synonym Symbols: CG1; F18; HYSP2; CXorf6
• NCBI Protein Information: mastermind-like domain-containing protein 1
• UniProt Protein Name: Mastermind-like domain-containing protein 1
• Protein Family: Mastermind-like domain-containing protein
• UniProt Gene Name: MAMLD1
• UniProt Synonym Gene Names: CG1; CXorf6
• UniProt Entry Name: MAMD1_HUMAN

NCBI Description

This gene encodes a mastermind-like domain containing protein. This protein may function as a transcriptional co-activator. Mutations in this gene are the cause of X-linked hypospadias type 2. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Apr 2010]

Uniprot Description

MAMLD1: Transactivates the HES3 promoter independently of NOTCH proteins. HES3 is a non-canonical NOTCH target gene which lacks binding sites for RBPJ. Defects in MAMLD1 are a cause of X-linked hypospadias type 2 (HYSP2). Hypospadias is a common malformation in which the urethra opens on the ventral side of the penis. It is considered a complex disorder with both genetic and environmental factors involved in the pathogenesis. Hypospadias can occur alone on an apparently multifactorial basis or as part of syndromes. Belongs to the mastermind family. 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: nucleus

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription, DNA-dependent; male gonad development

Disease: Hypospadias 2, X-linked