Western Blot (WB)
(AGR2 monoclonal antibody (M03), clone 1C3 Western Blot analysis of AGR2 expression in MCF-7 (Cat # L046V1).)
Mouse AGR2 Monoclonal Antibody | anti-AGR2 antibody
AGR2 (anterior gradient Homolog 2 (Xenopus laevis), AG2, GOB-4, HAG-2, XAG-2) (PE)
Applications
Western Blot
Purity
Purified
Synonyms
AGR2; Monoclonal Antibody; AGR2 (anterior gradient Homolog 2 (Xenopus laevis); AG2; GOB-4; HAG-2; XAG-2) (PE); anterior gradient Homolog 2 (Xenopus laevis); XAG-2; anti-AGR2 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1C3
Specificity
Recognizes AGR2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
175
Applicable Applications for anti-AGR2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
AGR2 (AAH15503.1, 1aa-175aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(AGR2 monoclonal antibody (M03), clone 1C3 Western Blot analysis of AGR2 expression in MCF-7 (Cat # L046V1).)
Western Blot (WB)
(AGR2 monoclonal antibody (M03), clone 1C3 Western Blot analysis of AGR2 expression in MCF-7 (Cat # L046V1).)
Western Blot (WB)
(Western Blot analysis of AGR2 expression in transfected 293T cell line by AGR2 monoclonal antibody (M03), clone 1C3.Lane 1: AGR2 transfected lysate (20 KDa).Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of AGR2 expression in transfected 293T cell line by AGR2 monoclonal antibody (M03), clone 1C3.Lane 1: AGR2 transfected lysate (20 KDa).Lane 2: Non-transfected lysate.)
Testing Data
(Detection limit for recombinant GST tagged AGR2 is approximately 0.03ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged AGR2 is approximately 0.03ng/ml as a capture antibody.)
Related Product Information for anti-AGR2 antibody
Mouse monoclonal antibody raised against a full length recombinant AGR2.
Product Categories/Family for anti-AGR2 antibody
References
1. Loss of Anterior Gradient-2 expression is an independent prognostic factor in colorectal carcinomas. Riener MO, Thiesler T, Hellerbrand C, Amann T, Cathomas G, Fritzsche FR, Dahl E, Bahra M, Weichert Terracciano L, Kristiansen GEur J Cancer. 2014 Apr 30. pii: S0959-8049(14)00597-8. doi: 10.1016/j.ejca.2014.04.012. 2.Development of a fluorescent monoclonal antibody-based assay to measure the allosteric effects of synthetic peptides on self-oligomerization of AGR2 protein. Gray TA, Murray E, Nowicki MW, Remnant L, Scherl A, Muller P, Vojtesek B, Hupp TRProtein Sci. 2013 Jun 18. doi: 10.1002/pro.2299. 3.Anterior gradient protein 2 (AGR2) is an independent prognostic factor in ovarian high-grade serous carcinoma. Darb-Esfahani S, Fritzsche F, Kristiansen G, Weichert W, Sehouli J, Braicu I, Dietel M, Denkert C.Virchows Arch. 2012 Jul 3. 4.Development of an ELISA to detect the secreted prostate cancer biomarker AGR2 in voided urine.Wayner EA, Quek SI, Ahmad R, Ho ME, Loprieno MA, Zhou Y, Ellis WJ, True LD, Liu AY.Prostate. 2012 Jun 15;72(9):1023-34. doi: 10.1002/pros.21508. Epub 2011 Nov 9. 5.Differential expression of the anterior gradient protein-2 is a conserved feature during morphogenesis and carcinogenesis of the biliary tree. Lepreux S, Bioulac-Sage P, Chevet E.Liver Int. 2011 Mar;31(3):322-8. doi: 10.1111/j.1478- 3231. 2010.02438.x. Epub 2011 Jan 21. 6.A Divergent Substrate-Binding Loop within the Pro-oncogenic Protein Anterior Gradient-2 Forms a Docking Site for Reptin. Maslon MM, Hrstka R, Vojtesek B, Hupp TR.J Mol Biol. 2010 Oct 1. 7. 2,3,7,8-Tetrachlorodibenzo-p-Dioxin Counteracts the p53 Response to a Genotoxicant by Upregulating Expression of the Metastasis Marker AGR2 in the Hepatocarcinoma Cell Line HepG2. Ambolet-Camoit A, Bui LC, Pierre S, Chevallier A, Marchand A, Coumoul X, Garlatti M, Andreau K, Barouki R, Aggerbeck M.Toxicol Sci. 2010 Jun;115(2):501-12. Epub 2010 Mar 18. 8.Identification of Candidate Biomarkers of Therapeutic Response to Docetaxel by Proteomic Profiling. Zhao L, Lee BY, Brown DA, Molloy MP, Marx GM, Pavlakis N, Boyer MJ, Stockler MR, Kaplan W, Breit SN, Sutherland RL, Henshall SM, Horvath LG.Cancer Res. 2009 Oct 1;69(19):7696-703. Epub 2009 Sep 22.
NCBI and Uniprot Product Information
NCBI GI #
NCBI Official Full Name
Anterior gradient homolog 2 (Xenopus laevis)
Protein Family
Similar Products
Product Notes
The AGR2 (Catalog #AAA6185918) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's AGR2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AGR2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AGR2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
