Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (FBLIM1 monoclonal antibody (M03), clone 3F8. Western Blot analysis of FBLIM1 expression in HepG2 (Cat # L019V1).)

Mouse FBLIM1 Monoclonal Antibody | anti-FBLIM1 antibody

FBLIM1 (filamin Binding LIM Protein 1, CAL, DKFZp434G171, FBLP-1, FBLP1, RP11-169K16.5) (HRP)

Gene Names
FBLIM1; CAL; FBLP1; FBLP-1
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
FBLIM1; Monoclonal Antibody; FBLIM1 (filamin Binding LIM Protein 1; CAL; DKFZp434G171; FBLP-1; FBLP1; RP11-169K16.5) (HRP); filamin Binding LIM Protein 1; RP11-169K16.5; anti-FBLIM1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3F8
Specificity
Recognizes FBLIM1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-FBLIM1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
FBLIM1 (NP_060026, 270aa-373aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VTCARCIGDESFALGSQNEVYCLDDFYRKFAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDCRILLSVEPTDQGCYPLNNHLFCKPCHVKRSAAGCC
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(FBLIM1 monoclonal antibody (M03), clone 3F8. Western Blot analysis of FBLIM1 expression in HepG2 (Cat # L019V1).)

Western Blot (WB) (FBLIM1 monoclonal antibody (M03), clone 3F8. Western Blot analysis of FBLIM1 expression in HepG2 (Cat # L019V1).)
Product Categories/Family for anti-FBLIM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43.1 kDa (396aa), confirmed by MALDI-TOF
NCBI Official Full Name
filamin-binding LIM protein 1 isoform a
NCBI Official Synonym Full Names
filamin binding LIM protein 1
NCBI Official Symbol
FBLIM1
NCBI Official Synonym Symbols
CAL; FBLP1; FBLP-1
NCBI Protein Information
filamin-binding LIM protein 1
UniProt Protein Name
Filamin-binding LIM protein 1
UniProt Gene Name
FBLIM1
UniProt Synonym Gene Names
FBLP1; FBLP-1
UniProt Entry Name
FBLI1_HUMAN

NCBI Description

This gene encodes a protein with an N-terminal filamin-binding domain, a central proline-rich domain, and, multiple C-terminal LIM domains. This protein localizes at cell junctions and may link cell adhesion structures to the actin cytoskeleton. This protein may be involved in the assembly and stabilization of actin-filaments and likely plays a role in modulating cell adhesion, cell morphology and cell motility. This protein also localizes to the nucleus and may affect cardiomyocyte differentiation after binding with the CSX/NKX2-5 transcription factor. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

FBLIM1: Serves as an anchoring site for cell-ECM adhesion proteins and filamin-containing actin filaments. Is implicated in cell shape modulation (spreading) and motility. May participate in the regulation of filamin-mediated cross-linking and stabilization of actin filaments. May also regulate the assembly of filamin- containing signaling complexes that control actin assembly. Promotes dissociation of FLNA from ITGB3 and ITGB7. Promotes activation of integrins and regulates integrin-mediated cell-cell adhesion. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 1p36.21

Cellular Component: focal adhesion; stress fiber; cell cortex; cytosol

Molecular Function: zinc ion binding; filamin binding

Biological Process: regulation of cell shape; cell-cell adhesion; regulation of integrin activation

Research Articles on FBLIM1

Similar Products

Product Notes

The FBLIM1 fblim1 (Catalog #AAA6181426) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's FBLIM1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FBLIM1 fblim1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FBLIM1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.