Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MEOX1 monoclonal antibody (M23), clone 1F3 Western Blot analysis of MEOX1 expression in Y-79 (Cat # L042V1).)

Mouse MEOX1 Monoclonal Antibody | anti-MEOX1 antibody

MEOX1 (Mesenchyme Homeobox 1, MOX1) (HRP)

Gene Names
MEOX1; KFS2; MOX1
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified
Synonyms
MEOX1; Monoclonal Antibody; MEOX1 (Mesenchyme Homeobox 1; MOX1) (HRP); Mesenchyme Homeobox 1; MOX1; anti-MEOX1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F3
Specificity
Recognizes MEOX1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-MEOX1 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
MEOX1 (NP_004518, 82aa-170aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGSTANETEKKSSRRRKESSDNQENRGKPEGSSK*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(MEOX1 monoclonal antibody (M23), clone 1F3 Western Blot analysis of MEOX1 expression in Y-79 (Cat # L042V1).)

Western Blot (WB) (MEOX1 monoclonal antibody (M23), clone 1F3 Western Blot analysis of MEOX1 expression in Y-79 (Cat # L042V1).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MEOX1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MEOX1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MEOX1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MEOX1 on HeLa cell. [antibody concentration 10 ug/ml])
Product Categories/Family for anti-MEOX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,628 Da
NCBI Official Full Name
homeobox protein MOX-1 isoform 1
NCBI Official Synonym Full Names
mesenchyme homeobox 1
NCBI Official Symbol
MEOX1
NCBI Official Synonym Symbols
KFS2; MOX1
NCBI Protein Information
homeobox protein MOX-1
UniProt Protein Name
Homeobox protein MOX-1
Protein Family
UniProt Gene Name
MEOX1
UniProt Synonym Gene Names
MOX1
UniProt Entry Name
MEOX1_HUMAN

NCBI Description

This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the molecular signaling network regulating somite development. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

MEOX1: Role in mesoderm induction and its earliest regional specification, somitogenesis, and myogenic and sclerotomal differentiation. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 17q21

Cellular Component: cytoplasm; nucleus

Molecular Function: sequence-specific DNA binding; chromatin binding; transcription factor activity

Biological Process: somite specification; transcription, DNA-dependent; multicellular organismal development; positive regulation of transcription from RNA polymerase II promoter

Disease: Klippel-feil Syndrome 2, Autosomal Recessive

Research Articles on MEOX1

Similar Products

Product Notes

The MEOX1 meox1 (Catalog #AAA6180559) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MEOX1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MEOX1 meox1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MEOX1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.