Western Blot (WB)
(Host: RabbitTarget Name: TAS2R123Sample Tissue: Mouse Heart lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse TAS2R123 Polyclonal Antibody | anti-TAS2R123 antibody
TAS2R123 Antibody - C-terminal region
Gene Names
Tas2r123; T2R23; mGR23; t2r55; mt2r55; Tas2r23
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
TAS2R123; Polyclonal Antibody; TAS2R123 Antibody - C-terminal region; anti-TAS2R123 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IIGILNLGLMEKIVILIFDHISGAVFPISHSFVLILGNSKLRQASLSVLP
Sequence Length
333
Applicable Applications for anti-TAS2R123 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse TAS2R123
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: TAS2R123Sample Tissue: Mouse Heart lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: TAS2R123Sample Tissue: Mouse Heart lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TAS2R123 antibody
Gustducin-coupled receptor implicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5 (By similarity).
Product Categories/Family for anti-TAS2R123 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38 kDa
NCBI Official Full Name
taste receptor type 2 member 123
NCBI Official Synonym Full Names
taste receptor, type 2, member 123
NCBI Official Symbol
Tas2r123
NCBI Official Synonym Symbols
T2R23; mGR23; t2r55; mt2r55; Tas2r23
NCBI Protein Information
taste receptor type 2 member 123
UniProt Protein Name
Taste receptor type 2 member 123
Protein Family
UniProt Gene Name
Tas2r123
UniProt Synonym Gene Names
T2r55; Tas2r23; T2R123; T2R23; mT2R55
UniProt Entry Name
TR123_MOUSE
Uniprot Description
Function: Gustducin-coupled receptor implicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5
By similarity.
Subcellular location: Membrane; Multi-pass membrane protein.
Tissue specificity: Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells. Expressed in the duodenum, antrum and fundus (part of the stomach). Ref.1
Miscellaneous: Several bitter taste receptors are expressed in a single taste receptor cell.
Sequence similarities: Belongs to the G-protein coupled receptor T2R family.
Caution: This protein was previously referred to as T2R2 but is now considered to be an ortholog of rat TAS2R23.
Similar Products
Product Notes
The TAS2R123 tas2r123 (Catalog #AAA3223999) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAS2R123 Antibody - C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TAS2R123 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TAS2R123 tas2r123 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IIGILNLGLM EKIVILIFDH ISGAVFPISH SFVLILGNSK LRQASLSVLP. It is sometimes possible for the material contained within the vial of "TAS2R123, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
