Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Mouse anti-Human HIP1R Monoclonal Antibody | anti-HIP1R antibody

HIP1R (Huntingtin-interacting Protein 1-related Protein, HIP1-related Protein, Huntingtin-interacting Protein 12, HIP-12, HIP12, KIAA0655)

Gene Names
HIP1R; HIP3; HIP12; ILWEQ
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
HIP1R; Monoclonal Antibody; HIP1R (Huntingtin-interacting Protein 1-related Protein; HIP1-related Protein; Huntingtin-interacting Protein 12; HIP-12; HIP12; KIAA0655); Anti -HIP1R (Huntingtin-interacting Protein 1-related Protein; anti-HIP1R antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3E10
Specificity
Recognizes human HIP1R.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
SGLSLIKLKKQEMETQVRVLELEKTLEAERMRLGELRKQHYVLAGASGSPGEEVAIRPSTAPRSVTTKKPPLAQKPSVAPRQDHQLDKKDGIYPAQLV
Applicable Applications for anti-HIP1R antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa969-1067 from HIP1R (NP_003950) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB)

(HIP1R monoclonal antibody Western Blot analysis of HIP1R expression in human liver.)

Western Blot (WB) (HIP1R monoclonal antibody Western Blot analysis of HIP1R expression in human liver.)

Western Blot (WB)

(HIP1R monoclonal antibody Western Blot analysis of HIP1R expression in A-431)

Western Blot (WB) (HIP1R monoclonal antibody Western Blot analysis of HIP1R expression in A-431)

Testing Data

(Detection limit for recombinant GST tagged HIP1R is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HIP1R is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-HIP1R antibody
Component of clathrin-coated pits and vesicles, that may link the endocytic machinery to the actin cytoskeleton. Binds 3-phosphoinositides (via ENTH domain). May act through the ENTH domain to promote cell survival by stabilizing receptor tyrosine kinases following ligand-induced endocytosis.
Product Categories/Family for anti-HIP1R antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
119,388 Da
NCBI Official Full Name
huntingtin-interacting protein 1-related protein
NCBI Official Synonym Full Names
huntingtin interacting protein 1 related
NCBI Official Symbol
HIP1R
NCBI Official Synonym Symbols
HIP3; HIP12; ILWEQ
NCBI Protein Information
huntingtin-interacting protein 1-related protein; HIP-12; HIP1-related protein; huntingtin interacting protein 12; huntingtin-interacting protein 12
UniProt Protein Name
Huntingtin-interacting protein 1-related protein
UniProt Gene Name
HIP1R
UniProt Synonym Gene Names
HIP12; KIAA0655; HIP1-related protein; HIP-12
UniProt Entry Name
HIP1R_HUMAN

Uniprot Description

HIP1R: Component of clathrin-coated pits and vesicles, that may link the endocytic machinery to the actin cytoskeleton. Binds 3- phosphoinositides (via ENTH domain). May act through the ENTH domain to promote cell survival by stabilizing receptor tyrosine kinases following ligand-induced endocytosis. Belongs to the SLA2 family.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 12q24

Cellular Component: cytoskeleton; clathrin-coated vesicle; intracellular membrane-bound organelle; perinuclear region of cytoplasm; cytoplasm; clathrin coated vesicle membrane; coated pit

Molecular Function: protein binding, bridging; protein binding; actin binding; phosphoinositide binding

Biological Process: receptor-mediated endocytosis; actin cytoskeleton organization and biogenesis

Research Articles on HIP1R

Similar Products

Product Notes

The HIP1R hip1r (Catalog #AAA6002262) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HIP1R (Huntingtin-interacting Protein 1-related Protein, HIP1-related Protein, Huntingtin-interacting Protein 12, HIP-12, HIP12, KIAA0655) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HIP1R can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the HIP1R hip1r for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SGLSLIKLKK QEMETQVRVL ELEKTLEAER MRLGELRKQH YVLAGASGSP GEEVAIRPST APRSVTTKKP PLAQKPSVAP RQDHQLDKKD GIYPAQLV. It is sometimes possible for the material contained within the vial of "HIP1R, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.