Mouse HGD Monoclonal Antibody | anti-HGD antibody

HGD (Homogentisate 1,2-dioxygenase (Homogentisate Oxidase), AKU, HGO) (AP)

Cat. Num. AAA6164786

• Gene Names: HGD; AKU; HGO
• Applications: Immunoprecipitation, Western Blot
• Purity: Purified
• Synonyms: HGD; Monoclonal Antibody; HGD (Homogentisate 1; 2-dioxygenase (Homogentisate Oxidase); AKU; HGO) (AP); Homogentisate 1; HGO; anti-HGD antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1F1
• Specificity: Recognizes HGD.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 329

• Applicable Applications for anti-HGD antibody: Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: HGD (AAH20792, 1aa-329aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESIDEGHVTHNWDEVDPDPNQLRWKPFEIPKASQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYILEVYGVHLELPDLGPIGANGLANPRDFLIPIAWYEDRQVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVLTALRRPARSSWHLRGLPMAPWHLCLNHL
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HGD expression in transfected 293T cell line by HGD monoclonal antibody (M11), clone 1F1.Lane 1: HGD transfected lysate(50 KDa).Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of HGD transfected lysate using anti-HGD monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with HGD MaxPab rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged HGD is 3 ng/ml as a capture antibody.)

Related Product Information for anti-HGD antibody

Homogentisate 1,2-dioxygenase (HGD) gene mutations are the molecular cause of alkaptonuria, a rare hereditary disorder of the phenylalanine catabolism. The highest expression of HGD is in the prostate, small intestine, colon, and liver. The HGD gene contains 14 exons. Conflicting reports have placed the gene at 3q2, 3q13.3-q21, 3q21-q24, 3q21-q23, or 3q25-q26. [provided by RefSeq]

Product Categories/Family for anti-HGD antibody

Antibodies; Enzymes; Oxidase

NCBI and Uniprot Product Information

• NCBI GI #: 18088530
• NCBI GeneID: 3081
• NCBI Official Full Name: Homogentisate 1,2-dioxygenase (homogentisate oxidase)
• NCBI Official Synonym Full Names: homogentisate 1,2-dioxygenase
• NCBI Official Symbol: HGD
• NCBI Official Synonym Symbols: AKU; HGO
• NCBI Protein Information: homogentisate 1,2-dioxygenase
• Protein Family: 2-(hydroxymethyl)glutarate dehydrogenase

NCBI Description

This gene encodes the enzyme homogentisate 1,2 dioxygenase. This enzyme is involved in the catabolism of the amino acids tyrosine and phenylalanine. Mutations in this gene are the cause of the autosomal recessive metabolism disorder alkaptonuria.[provided by RefSeq, May 2010]