Mouse anti-Human XCL1 Monoclonal Antibody | anti-XCL1 antibody

XCL1 (Lymphotactin, ATAC, C Motif Chemokine 1, Cytokine SCM-1, Lymphotaxin, SCM-1-alpha, Small-inducible Cytokine C1, XC Chemokine Ligand 1, LTN, SCYC1) (PE)

Cat. Num. AAA6161098

• Gene Names: XCL1; LTN; ATAC; LPTN; SCM1; SCM-1; SCM1A; SCYC1; SCM-1a
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: XCL1; Monoclonal Antibody; XCL1 (Lymphotactin; ATAC; C Motif Chemokine 1; Cytokine SCM-1; Lymphotaxin; SCM-1-alpha; Small-inducible Cytokine C1; XC Chemokine Ligand 1; LTN; SCYC1) (PE); anti-XCL1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1E1
• Specificity: Recognizes human XCL1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-XCL1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa22-115 from human XCL1 (NP_002986) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG*
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.34kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to XCL1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml].)

Product Categories/Family for anti-XCL1 antibody

Antibodies; Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 4506853
• NCBI GeneID: 6375
• NCBI Accession #: NP_002986
• NCBI GenBank Nucleotide #: NM_002995
• UniProt Accession #: P47992; Q52MA8
• Molecular Weight: 12.5 kDa (114aa), confirmed by MALDI-TOF. (Molecular weight on SDS-PAGE will appear higher)
• NCBI Official Full Name: lymphotactin
• NCBI Official Synonym Full Names: X-C motif chemokine ligand 1
• NCBI Official Symbol: XCL1
• NCBI Official Synonym Symbols: LTN; ATAC; LPTN; SCM1; SCM-1; SCM1A; SCYC1; SCM-1a
• NCBI Protein Information: lymphotactin
• UniProt Protein Name: Lymphotactin
• Protein Family: Lymphotactin
• UniProt Gene Name: XCL1
• UniProt Synonym Gene Names: LTN; SCYC1
• UniProt Entry Name: XCL1_HUMAN

NCBI Description

This antimicrobial gene encodes a member of the chemokine superfamily. Chemokines function in inflammatory and immunological responses, inducing leukocyte migration and activation. The encoded protein is a member of the C-chemokine subfamily, retaining only two of four cysteines conserved in other chemokines, and is thought to be specifically chemotactic for T cells. This gene and a closely related family member are located on the long arm of chromosome 1. [provided by RefSeq, Sep 2014]

Uniprot Description

XCL1: Chemotactic activity for lymphocytes but not for monocytes or neutrophils. Belongs to the intercrine gamma family.

Protein type: Secreted, signal peptide; Secreted; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 1q23

Cellular Component: extracellular space; extracellular region

Molecular Function: protein homodimerization activity; chemokine activity; chemokine receptor binding

Biological Process: neutrophil chemotaxis; negative regulation of T-helper 1 type immune response; positive regulation of T cell mediated cytotoxicity; negative regulation of transcription factor activity; response to virus; positive regulation of T cell cytokine production; positive regulation of leukocyte chemotaxis; negative regulation of T cell cytokine production; signal transduction; positive regulation of interleukin-10 production; negative regulation of interleukin-2 production; cell-cell signaling; negative regulation of interferon-gamma production; release of sequestered calcium ion into cytosol; regulation of inflammatory response; immune response; positive regulation of release of sequestered calcium ion into cytosol; negative regulation of transcription, DNA-dependent