Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.34kD).)

Mouse anti-Human XCL1 Monoclonal Antibody | anti-XCL1 antibody

XCL1 (Lymphotactin, ATAC, C Motif Chemokine 1, Cytokine SCM-1, Lymphotaxin, SCM-1-alpha, Small-inducible Cytokine C1, XC Chemokine Ligand 1, LTN, SCYC1) (AP)

Gene Names
XCL1; LTN; ATAC; LPTN; SCM1; SCM-1; SCM1A; SCYC1; SCM-1a
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
XCL1; Monoclonal Antibody; XCL1 (Lymphotactin; ATAC; C Motif Chemokine 1; Cytokine SCM-1; Lymphotaxin; SCM-1-alpha; Small-inducible Cytokine C1; XC Chemokine Ligand 1; LTN; SCYC1) (AP); anti-XCL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E1
Specificity
Recognizes human XCL1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-XCL1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa22-115 from human XCL1 (NP_002986) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.34kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.34kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to XCL1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to XCL1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml].)
Product Categories/Family for anti-XCL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12.5 kDa (114aa), confirmed by MALDI-TOF. (Molecular weight on SDS-PAGE will appear higher)
NCBI Official Full Name
lymphotactin
NCBI Official Synonym Full Names
X-C motif chemokine ligand 1
NCBI Official Symbol
XCL1
NCBI Official Synonym Symbols
LTN; ATAC; LPTN; SCM1; SCM-1; SCM1A; SCYC1; SCM-1a
NCBI Protein Information
lymphotactin
UniProt Protein Name
Lymphotactin
Protein Family
UniProt Gene Name
XCL1
UniProt Synonym Gene Names
LTN; SCYC1
UniProt Entry Name
XCL1_HUMAN

NCBI Description

This antimicrobial gene encodes a member of the chemokine superfamily. Chemokines function in inflammatory and immunological responses, inducing leukocyte migration and activation. The encoded protein is a member of the C-chemokine subfamily, retaining only two of four cysteines conserved in other chemokines, and is thought to be specifically chemotactic for T cells. This gene and a closely related family member are located on the long arm of chromosome 1. [provided by RefSeq, Sep 2014]

Uniprot Description

XCL1: Chemotactic activity for lymphocytes but not for monocytes or neutrophils. Belongs to the intercrine gamma family.

Protein type: Secreted, signal peptide; Secreted; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 1q23

Cellular Component: extracellular space; extracellular region

Molecular Function: protein homodimerization activity; chemokine activity; chemokine receptor binding

Biological Process: neutrophil chemotaxis; negative regulation of T-helper 1 type immune response; positive regulation of T cell mediated cytotoxicity; negative regulation of transcription factor activity; response to virus; positive regulation of T cell cytokine production; positive regulation of leukocyte chemotaxis; negative regulation of T cell cytokine production; signal transduction; positive regulation of interleukin-10 production; negative regulation of interleukin-2 production; cell-cell signaling; negative regulation of interferon-gamma production; release of sequestered calcium ion into cytosol; regulation of inflammatory response; immune response; positive regulation of release of sequestered calcium ion into cytosol; negative regulation of transcription, DNA-dependent

Research Articles on XCL1

Similar Products

Product Notes

The XCL1 xcl1 (Catalog #AAA6134583) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The XCL1 (Lymphotactin, ATAC, C Motif Chemokine 1, Cytokine SCM-1, Lymphotaxin, SCM-1-alpha, Small-inducible Cytokine C1, XC Chemokine Ligand 1, LTN, SCYC1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's XCL1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the XCL1 xcl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "XCL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.