Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Lymphotactin Recombinant Protein | XCL1 recombinant protein

Recombinant Human Lymphotactin protein

Gene Names
XCL1; LTN; ATAC; LPTN; SCM1; SCM-1; SCM1A; SCYC1; SCM-1a
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lymphotactin; Recombinant Human Lymphotactin protein; ATACC motif chemokine 1; Cytokine SCM-1; Lymphotaxin; SCM-1-alpha; Small-inducible cytokine C1XC chemokine ligand 1; XCL1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
22-114aa; Full Length
Sequence
VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
Sequence Length
114
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for XCL1 recombinant protein
Chotactic activity for lymphocytes but not for monocytes or neutrophils.
Product Categories/Family for XCL1 recombinant protein
References
Molecular cloning and functional characterization of human lymphotactin.Kennedy J., Kelner G.S., Kleyensteuber S., Schall T.J., Weiss M.C., Yssel H., Schneider P.V., Cocks B.G., Bacon K.B., Zlotnik A.J. Immunol. 155:203-209(1995) Molecular cloning of a novel C or gamma type chemokine, SCM-1.Yoshida T., Imai T., Kakizaki M., Nishimura M., Yoshie O.FEBS Lett. 360:155-159(1995) Cloning of ATAC, an activation-induced, chemokine-related molecule exclusively expressed in CD8+ T lymphocytes.Mueller S., Dorner B., Korthauer U., Mages H.W., D'Apuzzo M., Senger G., Kroczek R.A.Eur. J. Immunol. 25:1744-1748(1995) Structure and expression of two highly related genes encoding SCM-1/human lymphotactin.Yoshida T., Imai T., Takagi S., Nishimura M., Ishikawa I., Yaoi T., Yoshie O.FEBS Lett. 395:82-88(1996) The DNA sequence and biological annotation of human chromosome 1.Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.Nature 441:315-321(2006) Monomeric solution structure of the prototypical 'C' chemokine lymphotactin.Kuloglu E.S., McCaslin D.R., Kitabwalla M., Pauza C.D., Markley J.L., Volkman B.F.Biochemistry 40:12486-12496(2001)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14.3 kDa
NCBI Official Full Name
lymphotactin
NCBI Official Synonym Full Names
chemokine (C motif) ligand 1
NCBI Official Symbol
XCL1
NCBI Official Synonym Symbols
LTN; ATAC; LPTN; SCM1; SCM-1; SCM1A; SCYC1; SCM-1a
NCBI Protein Information
lymphotactin
UniProt Protein Name
Lymphotactin
Protein Family
UniProt Gene Name
XCL1
UniProt Synonym Gene Names
LTN; SCYC1
UniProt Entry Name
XCL1_HUMAN

NCBI Description

This antimicrobial gene encodes a member of the chemokine superfamily. Chemokines function in inflammatory and immunological responses, inducing leukocyte migration and activation. The encoded protein is a member of the C-chemokine subfamily, retaining only two of four cysteines conserved in other chemokines, and is thought to be specifically chemotactic for T cells. This gene and a closely related family member are located on the long arm of chromosome 1. [provided by RefSeq, Sep 2014]

Uniprot Description

XCL1: Chemotactic activity for lymphocytes but not for monocytes or neutrophils. Belongs to the intercrine gamma family.

Protein type: Motility/polarity/chemotaxis; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 1q23

Cellular Component: extracellular region; extracellular space; intracellular

Molecular Function: CCR chemokine receptor binding; chemokine activity; chemokine receptor binding; protein homodimerization activity

Biological Process: cell-cell signaling; G-protein coupled receptor protein signaling pathway; inflammatory response; monocyte chemotaxis; negative regulation of interferon-gamma production; negative regulation of interleukin-2 production; negative regulation of T cell cytokine production; negative regulation of T-helper 1 type immune response; negative regulation of transcription factor activity; negative regulation of transcription, DNA-dependent; neutrophil chemotaxis; positive regulation of GTPase activity; positive regulation of inflammatory response; positive regulation of interleukin-10 production; positive regulation of leukocyte chemotaxis; positive regulation of release of sequestered calcium ion into cytosol; positive regulation of T cell cytokine production; positive regulation of T cell mediated cytotoxicity; regulation of inflammatory response; release of sequestered calcium ion into cytosol; response to virus; signal transduction

Research Articles on XCL1

Similar Products

Product Notes

The XCL1 xcl1 (Catalog #AAA1265372) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-114aa; Full Length. The amino acid sequence is listed below: VGSEVSDKRT CVSLTTQRLP VSRIKTYTIT EGSLRAVIFI TKRGLKVCAD PQATWVRDVV RSMDRKSNTR NNMIQTKPTG TQQSTNTAVT LTG. It is sometimes possible for the material contained within the vial of "Lymphotactin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.