Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to KIF2C on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B. [antibody concentration 3ug/ml].)

Mouse anti-Human Kinesin 2C Monoclonal Antibody | anti-KIF2C antibody

Kinesin 2C (KIF2C, Kinesein Family Member 2C, Kinesin-Like Protein 6, KNSL6, Kinesin-like Protein KIF2C, Mitotic Centromere-Associated Kinesin, MCAK, 4930402F02Rik, ESTM5, MGC11883, OTTHUMP00000010066, X83316) (PE)

Gene Names
KIF2C; MCAK; CT139; KNSL6
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Kinesin 2C; Monoclonal Antibody; Kinesin 2C (KIF2C; Kinesein Family Member 2C; Kinesin-Like Protein 6; KNSL6; Kinesin-like Protein KIF2C; Mitotic Centromere-Associated Kinesin; MCAK; 4930402F02Rik; ESTM5; MGC11883; OTTHUMP00000010066; X83316) (PE); anti-KIF2C antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1G2
Specificity
Recognizes human KIF2C.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-KIF2C antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from human KIF2C (AAH14924) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAMDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGATKGKEIDFDDVAAINPELLQLLPLHPKDNLPLQENVTIQKQKRRSVNSKI
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to KIF2C on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B. [antibody concentration 3ug/ml].)

Testing Data (Immunoperoxidase of monoclonal antibody to KIF2C on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to KIF2C on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to KIF2C on HeLa cell. [antibody concentration 10ug/ml].)

Immunoprecipitation (IP)

(Immunoprecipitation of KIF2C transfected lysate using KIF2C monoclonal antibody and Protein A Magnetic Bead and immunoblotted with KIF2C rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of KIF2C transfected lysate using KIF2C monoclonal antibody and Protein A Magnetic Bead and immunoblotted with KIF2C rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged KIF2C is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged KIF2C is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of KIF2C over-expressed 293 cell line, cotransfected with KIF2C Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with KIF2C monoclonal antibody (M01). GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of KIF2C over-expressed 293 cell line, cotransfected with KIF2C Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with KIF2C monoclonal antibody (M01). GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB)

(Western Blot analysis of KIF2C expression in transfected 293T cell line by KIF2C monoclonal antibody Lane 1: KIF2C transfected lysate (81.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of KIF2C expression in transfected 293T cell line by KIF2C monoclonal antibody Lane 1: KIF2C transfected lysate (81.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(KIF2C monoclonal antibody Western Blot analysis of KIF2C expression in HeLa NE.)

Western Blot (WB) (KIF2C monoclonal antibody Western Blot analysis of KIF2C expression in HeLa NE.)
Product Categories/Family for anti-KIF2C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
75,561 Da
NCBI Official Full Name
Homo sapiens kinesin family member 2C, mRNA
NCBI Official Synonym Full Names
kinesin family member 2C
NCBI Official Symbol
KIF2C
NCBI Official Synonym Symbols
MCAK; CT139; KNSL6
NCBI Protein Information
kinesin-like protein KIF2C
Protein Family

NCBI Description

This gene encodes a kinesin-like protein that functions as a microtubule-dependent molecular motor. The encoded protein can depolymerize microtubules at the plus end, thereby promoting mitotic chromosome segregation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]

Research Articles on KIF2C

Similar Products

Product Notes

The KIF2C (Catalog #AAA6158511) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Kinesin 2C (KIF2C, Kinesein Family Member 2C, Kinesin-Like Protein 6, KNSL6, Kinesin-like Protein KIF2C, Mitotic Centromere-Associated Kinesin, MCAK, 4930402F02Rik, ESTM5, MGC11883, OTTHUMP00000010066, X83316) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Kinesin 2C can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KIF2C for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Kinesin 2C, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.