Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.78kD).)

Mouse anti-Human ABCA6 Monoclonal Antibody | anti-ABCA6 antibody

ABCA6 (ATP-binding Cassette Sub-family A Member 6) (PE)

Gene Names
ABCA6; EST155051
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ABCA6; Monoclonal Antibody; ABCA6 (ATP-binding Cassette Sub-family A Member 6) (PE); anti-ABCA6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F1
Specificity
Recognizes human ABCA6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
5321
Applicable Applications for anti-ABCA6 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa53-150 from ABCA6 (NP_525023) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NVQFPGMAPQNLGRVDKFNSSSLMVVYTPISNLTQQIMNKTALAPLLKGTSVIGAPNKTHMDEILLENLPYAMGIIFNETFSYKLIFFQGYNSPLWK*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.78kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.78kD).)
Related Product Information for anti-ABCA6 antibody
Probable transporter which may play a role in macrophage lipid homeostasis.
Product Categories/Family for anti-ABCA6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens ATP binding cassette subfamily A member 6 (ABCA6), mRNA
NCBI Official Synonym Full Names
ATP binding cassette subfamily A member 6
NCBI Official Symbol
ABCA6
NCBI Official Synonym Symbols
EST155051
NCBI Protein Information
ATP-binding cassette sub-family A member 6
UniProt Protein Name
ATP-binding cassette sub-family A member 6
Protein Family
UniProt Gene Name
ABCA6
UniProt Entry Name
ABCA6_HUMAN

NCBI Description

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This encoded protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This gene is clustered among 4 other ABC1 family members on 17q24 and may play a role in macrophage lipid homeostasis. [provided by RefSeq, Jul 2008]

Uniprot Description

ABCA6: Probable transporter which may play a role in macrophage lipid homeostasis. Belongs to the ABC transporter superfamily. ABCA family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter, ABC family; Membrane protein, integral; Membrane protein, multi-pass; Transporter

Chromosomal Location of Human Ortholog: 17q24.3

Cellular Component: integral to membrane

Molecular Function: transporter activity; ATPase activity; ATP binding

Biological Process: metabolic process; transport

Research Articles on ABCA6

Similar Products

Product Notes

The ABCA6 abca6 (Catalog #AAA6156321) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ABCA6 (ATP-binding Cassette Sub-family A Member 6) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ABCA6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ABCA6 abca6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ABCA6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.