Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.91kD).)

Mouse anti-Human ABCA10 Monoclonal Antibody | anti-ABCA10 antibody

ABCA10 (ATP-binding Cassette Sub-family A Member 10) APC

Gene Names
ABCA10; EST698739
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ABCA10; Monoclonal Antibody; ABCA10 (ATP-binding Cassette Sub-family A Member 10) APC; anti-ABCA10 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
8F4
Specificity
Recognizes human ABCA10.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1543
Applicable Applications for anti-ABCA10 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-80 from ABCA10 (NP_525021) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MNKMALASFMKGRTVIGTPDEETMDIELPKKYHEMVGVIFSDTFSYRLKFNWGYRIPVIKEHSEYTEHCWAMHGEIFCYL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.91kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.91kD).)

Testing Data

(Detection limit for recombinant GST tagged ABCA10 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ABCA10 is 1ng/ml as a capture antibody.)
Related Product Information for anti-ABCA10 antibody
Probable transporter which may play a role in macrophage lipid homeostasis.
Product Categories/Family for anti-ABCA10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
ATP-binding cassette sub-family A member 10
NCBI Official Synonym Full Names
ATP binding cassette subfamily A member 10
NCBI Official Symbol
ABCA10
NCBI Official Synonym Symbols
EST698739
NCBI Protein Information
ATP-binding cassette sub-family A member 10
UniProt Protein Name
ATP-binding cassette sub-family A member 10
Protein Family
UniProt Gene Name
ABCA10

NCBI Description

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This encoded protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This gene is clustered among 4 other ABC1 family members on 17q24, but neither the substrate nor the function of this gene is known. [provided by RefSeq, Jul 2008]

Uniprot Description

Probable transporter which may play a role in macrophage lipid homeostasis.

Research Articles on ABCA10

Similar Products

Product Notes

The ABCA10 abca10 (Catalog #AAA6135108) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ABCA10 (ATP-binding Cassette Sub-family A Member 10) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ABCA10 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ABCA10 abca10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ABCA10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.