Mouse anti-Human SLC13A5 Monoclonal Antibody | anti-SLC13A5 antibody

SLC13A5 (Solute Carrier Family 13 Member 5, Na(+)/citrate Cotransporter, NaCT, Sodium-coupled Citrate Transporter, Sodium-dependent Citrate Transporter) (HRP)

Cat. Num. AAA6154993

• Gene Names: SLC13A5; INDY; NACT; mIndy; EIEE25
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SLC13A5; Monoclonal Antibody; SLC13A5 (Solute Carrier Family 13 Member 5; Na(+)/citrate Cotransporter; NaCT; Sodium-coupled Citrate Transporter; Sodium-dependent Citrate Transporter) (HRP); anti-SLC13A5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2G4
• Specificity: Recognizes human SLC13A5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 568

• Applicable Applications for anti-SLC13A5 antibody: ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Sandwich ELISA: The detection limit is 0.03ng/ml as a capture antibody.; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa152-207 from human SLC13A5 (NP_808218) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VEAILQQMEATSAATEAGLELVDKGKAKELPGSQVIFEGPTLGQQEDQERKRLCK*
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.16kD).)

Western Blot (WB)

(SLC13A5 monoclonal antibody. Western Blot analysis of SLC13A5 expression in HepG2.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SLC13A5 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged SLC13A5 is 0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-SLC13A5 antibody

Antibodies; Transport Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 29171306
• NCBI GeneID: 284111
• NCBI Accession #: NP_808218
• NCBI GenBank Nucleotide #: NM_177550
• UniProt Accession #: Q86YT5
• NCBI Official Full Name: solute carrier family 13 member 5 isoform a
• NCBI Official Synonym Full Names: solute carrier family 13 member 5
• NCBI Official Symbol: SLC13A5
• NCBI Official Synonym Symbols: INDY; NACT; mIndy; EIEE25
• NCBI Protein Information: solute carrier family 13 member 5
• UniProt Protein Name: Solute carrier family 13 member 5
• Protein Family: Solute carrier family
• UniProt Gene Name: SLC13A5
• UniProt Synonym Gene Names: NACT; NaCT
• UniProt Entry Name: S13A5_HUMAN

NCBI Description

This gene encodes a protein belonging to the solute carrier family 13 group of proteins. This family member is a sodium-dependent citrate cotransporter that may regulate metabolic processes. Mutations in this gene cause early infantile epileptic encephalopathy 25. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2014]

Uniprot Description

SLC13A5: High-affinity sodium/citrate cotransporter that mediates citrate entry into cells. The transport process is electrogenic; it is the trivalent form of citrate rather than the divalent form that is recognized as a substrate. May facilitate the utilization of circulating citrate for the generation of metabolic energy and for the synthesis of fatty acids and cholesterol. Belongs to the SLC13A/DASS transporter (TC 2.A.47) family. NADC subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Transporter; Membrane protein, multi-pass; Transporter, SLC family

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: basolateral plasma membrane; integral to membrane; plasma membrane

Molecular Function: citrate transmembrane transporter activity; succinate transmembrane transporter activity; sodium:dicarboxylate symporter activity

Biological Process: citrate transport; sodium ion transport; transmembrane transport

Disease: Epileptic Encephalopathy, Early Infantile, 25