Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.16kD).)

Mouse anti-Human SLC13A5 Monoclonal Antibody | anti-SLC13A5 antibody

SLC13A5 (Solute Carrier Family 13 Member 5, Na(+)/citrate Cotransporter, NaCT, Sodium-coupled Citrate Transporter, Sodium-dependent Citrate Transporter) (Biotin)

Gene Names
SLC13A5; INDY; NACT; mIndy; EIEE25
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC13A5; Monoclonal Antibody; SLC13A5 (Solute Carrier Family 13 Member 5; Na(+)/citrate Cotransporter; NaCT; Sodium-coupled Citrate Transporter; Sodium-dependent Citrate Transporter) (Biotin); anti-SLC13A5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G4
Specificity
Recognizes human SLC13A5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
568
Applicable Applications for anti-SLC13A5 antibody
ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Sandwich ELISA: The detection limit is 0.03ng/ml as a capture antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa152-207 from human SLC13A5 (NP_808218) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VEAILQQMEATSAATEAGLELVDKGKAKELPGSQVIFEGPTLGQQEDQERKRLCK*
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.16kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.16kD).)

Western Blot (WB)

(SLC13A5 monoclonal antibody. Western Blot analysis of SLC13A5 expression in HepG2.)

Western Blot (WB) (SLC13A5 monoclonal antibody. Western Blot analysis of SLC13A5 expression in HepG2.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SLC13A5 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to SLC13A5 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged SLC13A5 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SLC13A5 is 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-SLC13A5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
solute carrier family 13 member 5 isoform a
NCBI Official Synonym Full Names
solute carrier family 13 member 5
NCBI Official Symbol
SLC13A5
NCBI Official Synonym Symbols
INDY; NACT; mIndy; EIEE25
NCBI Protein Information
solute carrier family 13 member 5
UniProt Protein Name
Solute carrier family 13 member 5
Protein Family
UniProt Gene Name
SLC13A5
UniProt Synonym Gene Names
NACT; NaCT
UniProt Entry Name
S13A5_HUMAN

NCBI Description

This gene encodes a protein belonging to the solute carrier family 13 group of proteins. This family member is a sodium-dependent citrate cotransporter that may regulate metabolic processes. Mutations in this gene cause early infantile epileptic encephalopathy 25. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2014]

Uniprot Description

SLC13A5: High-affinity sodium/citrate cotransporter that mediates citrate entry into cells. The transport process is electrogenic; it is the trivalent form of citrate rather than the divalent form that is recognized as a substrate. May facilitate the utilization of circulating citrate for the generation of metabolic energy and for the synthesis of fatty acids and cholesterol. Belongs to the SLC13A/DASS transporter (TC 2.A.47) family. NADC subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Transporter; Membrane protein, multi-pass; Transporter, SLC family

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: basolateral plasma membrane; integral to membrane; plasma membrane

Molecular Function: citrate transmembrane transporter activity; succinate transmembrane transporter activity; sodium:dicarboxylate symporter activity

Biological Process: citrate transport; sodium ion transport; transmembrane transport

Disease: Epileptic Encephalopathy, Early Infantile, 25

Research Articles on SLC13A5

Similar Products

Product Notes

The SLC13A5 slc13a5 (Catalog #AAA6144387) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC13A5 (Solute Carrier Family 13 Member 5, Na(+)/citrate Cotransporter, NaCT, Sodium-coupled Citrate Transporter, Sodium-dependent Citrate Transporter) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC13A5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB). Sandwich ELISA: The detection limit is 0.03ng/ml as a capture antibody. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC13A5 slc13a5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC13A5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.