Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (RPS6KA2 monoclonal antibody, Western Blot analysis of RPS6KA2 expression in Hela NE.)

Mouse anti-Human RSK3 Monoclonal Antibody | anti-RSK3 antibody

RSK3, CT (Ribosomal S6 Kinase 3, RSK-3, pp90RSK3, 90kD Ribosomal Protein S6 Kinase 2, p90-RSK 2, p90RSK2, MAP Kinase-activated Protein Kinase 1c, MAPK-activated Protein Kinase 1c, MAPKAP Kinase 1c, MAPKAPK1C, MAPKAPK-1c, Ribosomal Protein S6 Kinase alpha-

Gene Names
RPS6KA2; RSK; HU-2; RSK3; p90RSK2; p90-RSK3; pp90RSK3; MAPKAPK1C; S6K-alpha; S6K-alpha2
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RSK3; Monoclonal Antibody; CT (Ribosomal S6 Kinase 3; RSK-3; pp90RSK3; 90kD Ribosomal Protein S6 Kinase 2; p90-RSK 2; p90RSK2; MAP Kinase-activated Protein Kinase 1c; MAPK-activated Protein Kinase 1c; MAPKAP Kinase 1c; MAPKAPK1C; MAPKAPK-1c; Ribosomal Protein S6 Kinase alpha-; anti-RSK3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F6
Specificity
Recognizes human RPS6KA2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
3973
Applicable Applications for anti-RSK3 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa631-733 from human RPS6KA2 (AAH02363) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YALSGGNWDSISDAAKDVVSKMLHVDPHQRLTAMQVLKHPWVVNREYLSPNQLSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTRL
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(RPS6KA2 monoclonal antibody, Western Blot analysis of RPS6KA2 expression in Hela NE.)

Western Blot (WB) (RPS6KA2 monoclonal antibody, Western Blot analysis of RPS6KA2 expression in Hela NE.)

Western Blot (WB)

(Western Blot analysis of RPS6KA2 expression in transfected 293T cell line by RPS6KA2 monoclonal antibody. Lane 1: RPS6KA2 transfected lysate (83.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RPS6KA2 expression in transfected 293T cell line by RPS6KA2 monoclonal antibody. Lane 1: RPS6KA2 transfected lysate (83.2kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RPS6KA2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to RPS6KA2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RPS6KA2 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RPS6KA2 on HeLa cell. [antibody concentration 10ug/ml])

Western Blot (WB)

(Western blot analysis of RPS6KA2 over-expressed 293 cell line, cotransfected with RPS6KA2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RPS6KA2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of RPS6KA2 over-expressed 293 cell line, cotransfected with RPS6KA2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RPS6KA2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between MAPK3 and RPS6KA2 HeLa cells were stained with anti-MAPK3 rabbit purified polyclonal 1:1200 and anti-RPS6KA2 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between MAPK3 and RPS6KA2 HeLa cells were stained with anti-MAPK3 rabbit purified polyclonal 1:1200 and anti-RPS6KA2 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Product Categories/Family for anti-RSK3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens ribosomal protein S6 kinase, 90kDa, polypeptide 2, mRNA
NCBI Official Synonym Full Names
ribosomal protein S6 kinase A2
NCBI Official Symbol
RPS6KA2
NCBI Official Synonym Symbols
RSK; HU-2; RSK3; p90RSK2; p90-RSK3; pp90RSK3; MAPKAPK1C; S6K-alpha; S6K-alpha2
NCBI Protein Information
ribosomal protein S6 kinase alpha-2

NCBI Description

This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains two non-identical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Alternative splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jan 2016]

Research Articles on RSK3

Similar Products

Product Notes

The RSK3 (Catalog #AAA6154773) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RSK3, CT (Ribosomal S6 Kinase 3, RSK-3, pp90RSK3, 90kD Ribosomal Protein S6 Kinase 2, p90-RSK 2, p90RSK2, MAP Kinase-activated Protein Kinase 1c, MAPK-activated Protein Kinase 1c, MAPKAP Kinase 1c, MAPKAPK1C, MAPKAPK-1c, Ribosomal Protein S6 Kinase alpha- reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RSK3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RSK3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RSK3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.