Mouse anti-Human PIK3CA Monoclonal Antibody | anti-PIK3CA antibody

PIK3CA (Phosphatidylinositol-4,5-bisphosphate 3-kinase Catalytic Subunit alpha Isoform, PtdIns-3-kinase Subunit alpha, PI3-kinase Subunit alpha, PI3K-alpha, Phosphatidylinositol-4,5-bisphosphate 3-kinase 110kD Catalytic Subunit alpha, PtdIns-3-kinase Subu

Cat. Num. AAA6154167

• Gene Names: PIK3CA; MCM; CWS5; MCAP; PI3K; CLOVE; MCMTC; p110-alpha
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PIK3CA; Monoclonal Antibody; PIK3CA (Phosphatidylinositol-4; 5-bisphosphate 3-kinase Catalytic Subunit alpha Isoform; PtdIns-3-kinase Subunit alpha; PI3-kinase Subunit alpha; PI3K-alpha; Phosphatidylinositol-4; 5-bisphosphate 3-kinase 110kD Catalytic Subunit alpha; PtdIns-3-kinase Subu; anti-PIK3CA antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3G3
• Specificity: Recognizes human PIK3CA.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-PIK3CA antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa959-1069 from human PIK3CA (NP_006209) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PIK3CA is ~1ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis of protein-protein interactions between APPL1 and PIK3CA HeLa cells were stained with APPL1 rabbit purified polyclonal 1:1200 and PIK3CA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Related Product Information for anti-PIK3CA antibody

Phosphatidylinositol 3-kinase is composed of an 85kD regulatory subunit and a 110kD catalytic subunit. The protein encoded by this gene represents the catalytic subunit, which uses ATP to phosphorylate PtdIns, PtdIns4P and PtdIns(4,5)P2. This gene has been found to be oncogenic and has been implicated in cervical cancers.

Product Categories/Family for anti-PIK3CA antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 54792082
• NCBI GeneID: 5290
• NCBI Accession #: NP_006209
• NCBI GenBank Nucleotide #: NM_006218
• UniProt Accession #: P42336; Q14CW1; Q99762
• Molecular Weight: 124,284 Da
• NCBI Official Full Name: phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
• NCBI Official Synonym Full Names: phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit alpha
• NCBI Official Symbol: PIK3CA
• NCBI Official Synonym Symbols: MCM; CWS5; MCAP; PI3K; CLOVE; MCMTC; p110-alpha
• NCBI Protein Information: phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform; PI3-kinase p110 subunit alpha; PI3K-alpha; phosphatidylinositol 3-kinase, catalytic, 110-KD, alpha; phosphatidylinositol 3-kinase, catalytic, alpha polypeptide; phosphatidylin
• UniProt Protein Name: Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
• Protein Family: Phosphatidylinositol 4,5-bisphosphate 3-kinase
• UniProt Gene Name: PIK3CA
• UniProt Synonym Gene Names: PI3-kinase subunit alpha; PI3K-alpha; PI3Kalpha; PtdIns-3-kinase subunit alpha; PtdIns-3-kinase subunit p110-alpha; p110alpha
• UniProt Entry Name: PK3CA_HUMAN

Uniprot Description

PIK3CA: Phosphoinositide-3-kinase (PI3K) that phosphorylates PtdIns (Phosphatidylinositol), PtdIns4P (Phosphatidylinositol 4- phosphate) and PtdIns(4,5)P2 (Phosphatidylinositol 4,5- bisphosphate) to generate phosphatidylinositol 3,4,5-trisphosphate (PIP3). PIP3 plays a key role by recruiting PH domain-containing proteins to the membrane, including AKT1 and PDPK1, activating signaling cascades involved in cell growth, survival, proliferation, motility and morphology. Participates in cellular signaling in response to various growth factors. Involved in the activation of AKT1 upon stimulation by receptor tyrosine kinases ligands such as EGF, insulin, IGF1, VEGFA and PDGF. Involved in signaling via insulin-receptor substrate (IRS) proteins. Essential in endothelial cell migration during vascular development through VEGFA signaling, possibly by regulating RhoA activity. Required for lymphatic vasculature development, possibly by binding to RAS and by activation by EGF and FGF2, but not by PDGF. Regulates invadopodia formation in breast cancer cells through the PDPK1- AKT1 pathway. Participates in cardiomyogenesis in embryonic stem cells through a AKT1 pathway. Participates in vasculogenesis in embryonic stem cells through PDK1 and protein kinase C pathway. Has also serine-protein kinase activity: phosphorylates PIK3R1 (p85alpha regulatory subunit), EIF4EBP1 and HRAS. Heterodimer of a catalytic subunit PIK3CA and a p85 regulatory subunit (PIK3R1, PIK3R2 or PIK3R3). Interacts with IRS1 in nuclear extracts. Interacts with RUFY3. Interacts with RASD2. Interacts with APPL1. Interacts with HRAS1 and KRAS. Interaction with HRAS1/KRAS is required for PI3K pathway signaling and cell proliferation stimulated by EGF and FGF2. Belongs to the PI3/PI4-kinase family.

Protein type: Motility/polarity/chemotaxis; Oncoprotein; EC 2.7.11.1; EC 2.7.1.153; Kinase, lipid; Carbohydrate Metabolism - inositol phosphate

Chromosomal Location of Human Ortholog: 3q26.3

Cellular Component: lamellipodium; plasma membrane; phosphoinositide 3-kinase complex; cytosol

Molecular Function: protein serine/threonine kinase activity; protein binding; phosphatidylinositol-4,5-bisphosphate 3-kinase activity; insulin receptor substrate binding; 1-phosphatidylinositol-3-kinase activity; kinase activity; protein kinase activator activity; ATP binding; phosphatidylinositol-4-phosphate 3-kinase activity; phosphoinositide 3-kinase activity

Biological Process: epidermal growth factor receptor signaling pathway; platelet activation; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; nerve growth factor receptor signaling pathway; regulation of multicellular organism growth; glucose metabolic process; positive regulation of peptidyl-serine phosphorylation; T cell receptor signaling pathway; protein amino acid phosphorylation; vasculature development; phosphoinositide phosphorylation; positive regulation of protein kinase activity; phospholipid metabolic process; T cell costimulation; phosphatidylinositol biosynthetic process; protein kinase B signaling cascade; insulin receptor signaling pathway; innate immune response; endothelial cell migration; negative regulation of neuron apoptosis; angiogenesis; blood coagulation; vascular endothelial growth factor receptor signaling pathway; leukocyte migration; cardiac muscle contraction

Disease: Cowden Syndrome 5; Gastric Cancer; Keratosis, Seborrheic; Breast Cancer; Lung Cancer; Ovarian Cancer; Congenital Lipomatous Overgrowth, Vascular Malformations, And Epidermal Nevi; Colorectal Cancer; Megalencephaly-capillary Malformation-polymicrogyria Syndrome; Hepatocellular Carcinoma; Nevus, Epidermal