Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PIK3CASample Tissue: Human A549 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human PIK3CA Polyclonal Antibody | anti-PIK3CA antibody

PIK3CA Antibody - middle region

Gene Names
PIK3CA; MCM; CWS5; MCAP; PI3K; CLAPO; CLOVE; MCMTC; PI3K-alpha; p110-alpha
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PIK3CA; Polyclonal Antibody; PIK3CA Antibody - middle region; anti-PIK3CA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQL
Sequence Length
1608
Applicable Applications for anti-PIK3CA antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PIK3CA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PIK3CASample Tissue: Human A549 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PIK3CASample Tissue: Human A549 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PIK3CA antibody
Phosphatidylinositol 3-kinase is composed of an 85 kDa regulatory subunit and a 110 kDa catalytic subunit. The protein encoded by this gene represents the catalytic subunit, which uses ATP to phosphorylate PtdIns, PtdIns4P and PtdIns(4,5)P2. This gene has been found to be oncogenic and has been implicated in cervical cancers.
Product Categories/Family for anti-PIK3CA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
117 kDa
NCBI Official Full Name
phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
NCBI Official Synonym Full Names
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha
NCBI Official Symbol
PIK3CA
NCBI Official Synonym Symbols
MCM; CWS5; MCAP; PI3K; CLAPO; CLOVE; MCMTC; PI3K-alpha; p110-alpha
NCBI Protein Information
phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
UniProt Protein Name
Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
UniProt Gene Name
Pik3ca
UniProt Synonym Gene Names
PI3-kinase subunit alpha; PI3K-alpha; PI3Kalpha; PtdIns-3-kinase subunit alpha; PtdIns-3-kinase subunit p110-alpha; p110alpha
UniProt Entry Name
PK3CA_MOUSE

NCBI Description

Phosphatidylinositol 3-kinase is composed of an 85 kDa regulatory subunit and a 110 kDa catalytic subunit. The protein encoded by this gene represents the catalytic subunit, which uses ATP to phosphorylate PtdIns, PtdIns4P and PtdIns(4,5)P2. This gene has been found to be oncogenic and has been implicated in cervical cancers. A pseudogene of this gene has been defined on chromosome 22. [provided by RefSeq, Apr 2016]

Uniprot Description

PIK3CA: Phosphoinositide-3-kinase (PI3K) that phosphorylates PtdIns (Phosphatidylinositol), PtdIns4P (Phosphatidylinositol 4- phosphate) and PtdIns(4,5)P2 (Phosphatidylinositol 4,5- bisphosphate) to generate phosphatidylinositol 3,4,5-trisphosphate (PIP3). PIP3 plays a key role by recruiting PH domain-containing proteins to the membrane, including AKT1 and PDPK1, activating signaling cascades involved in cell growth, survival, proliferation, motility and morphology. Participates in cellular signaling in response to various growth factors. Involved in the activation of AKT1 upon stimulation by receptor tyrosine kinases ligands such as EGF, insulin, IGF1, VEGFA and PDGF. Involved in signaling via insulin-receptor substrate (IRS) proteins. Essential in endothelial cell migration during vascular development through VEGFA signaling, possibly by regulating RhoA activity. Required for lymphatic vasculature development, possibly by binding to RAS and by activation by EGF and FGF2, but not by PDGF. Regulates invadopodia formation in breast cancer cells through the PDPK1- AKT1 pathway. Participates in cardiomyogenesis in embryonic stem cells through a AKT1 pathway. Participates in vasculogenesis in embryonic stem cells through PDK1 and protein kinase C pathway. Has also serine-protein kinase activity: phosphorylates PIK3R1 (p85alpha regulatory subunit), EIF4EBP1 and HRAS. Heterodimer of a catalytic subunit PIK3CA and a p85 regulatory subunit (PIK3R1, PIK3R2 or PIK3R3). Interacts with IRS1 in nuclear extracts. Interacts with RUFY3. Interacts with RASD2. Interacts with APPL1. Interacts with HRAS1 and KRAS. Interaction with HRAS1/KRAS is required for PI3K pathway signaling and cell proliferation stimulated by EGF and FGF2. Belongs to the PI3/PI4-kinase family.

Protein type: Motility/polarity/chemotaxis; Oncoprotein; EC 2.7.11.1; Carbohydrate Metabolism - inositol phosphate; EC 2.7.1.153; Kinase, lipid

Cellular Component: lamellipodium; plasma membrane; intracellular; phosphoinositide 3-kinase complex

Molecular Function: transferase activity; protein serine/threonine kinase activity; protein binding; phosphatidylinositol-4,5-bisphosphate 3-kinase activity; 1-phosphatidylinositol-3-kinase activity; insulin receptor substrate binding; transferase activity, transferring phosphorus-containing groups; nucleotide binding; kinase activity; phosphotransferase activity, alcohol group as acceptor; protein kinase activator activity; phosphatidylinositol-4-phosphate 3-kinase activity; ATP binding

Biological Process: phosphoinositide-mediated signaling; phosphoinositide phosphorylation; positive regulation of protein kinase activity; protein kinase B signaling cascade; glucose metabolic process; regulation of multicellular organism growth; angiogenesis; negative regulation of neuron apoptosis; positive regulation of peptidyl-serine phosphorylation; protein amino acid phosphorylation; phosphorylation

Research Articles on PIK3CA

Similar Products

Product Notes

The PIK3CA pik3ca (Catalog #AAA3221289) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PIK3CA Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PIK3CA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PIK3CA pik3ca for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IIVVIWVIVS PNNDKQKYTL KINHDCVPEQ VIAEAIRKKT RSMLLSSEQL. It is sometimes possible for the material contained within the vial of "PIK3CA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.