Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged PIK3CA is ~1ng/ml as a capture antibody.)

Mouse anti-Human PIK3CA Monoclonal Antibody | anti-PIK3CA antibody

PIK3CA (Phosphatidylinositol-4,5-bisphosphate 3-kinase Catalytic Subunit alpha Isoform, PtdIns-3-kinase Subunit alpha, PI3-kinase Subunit alpha, PI3K-alpha, Phosphatidylinositol-4,5-bisphosphate 3-kinase 110kD Catalytic Subunit alpha, PtdIns-3-kinase Subu

Gene Names
PIK3CA; MCM; CWS5; MCAP; PI3K; CLOVE; MCMTC; p110-alpha
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PIK3CA; Monoclonal Antibody; PIK3CA (Phosphatidylinositol-4; 5-bisphosphate 3-kinase Catalytic Subunit alpha Isoform; PtdIns-3-kinase Subunit alpha; PI3-kinase Subunit alpha; PI3K-alpha; Phosphatidylinositol-4; 5-bisphosphate 3-kinase 110kD Catalytic Subunit alpha; PtdIns-3-kinase Subu; anti-PIK3CA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3G3
Specificity
Recognizes human PIK3CA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-PIK3CA antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa959-1069 from human PIK3CA (NP_006209) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PIK3CA is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PIK3CA is ~1ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis of protein-protein interactions between APPL1 and PIK3CA HeLa cells were stained with APPL1 rabbit purified polyclonal 1:1200 and PIK3CA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Testing Data (Proximity Ligation Analysis of protein-protein interactions between APPL1 and PIK3CA HeLa cells were stained with APPL1 rabbit purified polyclonal 1:1200 and PIK3CA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)
Related Product Information for anti-PIK3CA antibody
Phosphatidylinositol 3-kinase is composed of an 85kD regulatory subunit and a 110kD catalytic subunit. The protein encoded by this gene represents the catalytic subunit, which uses ATP to phosphorylate PtdIns, PtdIns4P and PtdIns(4,5)P2. This gene has been found to be oncogenic and has been implicated in cervical cancers.
Product Categories/Family for anti-PIK3CA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
124,284 Da
NCBI Official Full Name
phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
NCBI Official Synonym Full Names
phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit alpha
NCBI Official Symbol
PIK3CA
NCBI Official Synonym Symbols
MCM; CWS5; MCAP; PI3K; CLOVE; MCMTC; p110-alpha
NCBI Protein Information
phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform; PI3-kinase p110 subunit alpha; PI3K-alpha; phosphatidylinositol 3-kinase, catalytic, 110-KD, alpha; phosphatidylinositol 3-kinase, catalytic, alpha polypeptide; phosphatidylin
UniProt Protein Name
Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
UniProt Gene Name
PIK3CA
UniProt Synonym Gene Names
PI3-kinase subunit alpha; PI3K-alpha; PI3Kalpha; PtdIns-3-kinase subunit alpha; PtdIns-3-kinase subunit p110-alpha; p110alpha
UniProt Entry Name
PK3CA_HUMAN

Uniprot Description

PIK3CA: Phosphoinositide-3-kinase (PI3K) that phosphorylates PtdIns (Phosphatidylinositol), PtdIns4P (Phosphatidylinositol 4- phosphate) and PtdIns(4,5)P2 (Phosphatidylinositol 4,5- bisphosphate) to generate phosphatidylinositol 3,4,5-trisphosphate (PIP3). PIP3 plays a key role by recruiting PH domain-containing proteins to the membrane, including AKT1 and PDPK1, activating signaling cascades involved in cell growth, survival, proliferation, motility and morphology. Participates in cellular signaling in response to various growth factors. Involved in the activation of AKT1 upon stimulation by receptor tyrosine kinases ligands such as EGF, insulin, IGF1, VEGFA and PDGF. Involved in signaling via insulin-receptor substrate (IRS) proteins. Essential in endothelial cell migration during vascular development through VEGFA signaling, possibly by regulating RhoA activity. Required for lymphatic vasculature development, possibly by binding to RAS and by activation by EGF and FGF2, but not by PDGF. Regulates invadopodia formation in breast cancer cells through the PDPK1- AKT1 pathway. Participates in cardiomyogenesis in embryonic stem cells through a AKT1 pathway. Participates in vasculogenesis in embryonic stem cells through PDK1 and protein kinase C pathway. Has also serine-protein kinase activity: phosphorylates PIK3R1 (p85alpha regulatory subunit), EIF4EBP1 and HRAS. Heterodimer of a catalytic subunit PIK3CA and a p85 regulatory subunit (PIK3R1, PIK3R2 or PIK3R3). Interacts with IRS1 in nuclear extracts. Interacts with RUFY3. Interacts with RASD2. Interacts with APPL1. Interacts with HRAS1 and KRAS. Interaction with HRAS1/KRAS is required for PI3K pathway signaling and cell proliferation stimulated by EGF and FGF2. Belongs to the PI3/PI4-kinase family.

Protein type: Motility/polarity/chemotaxis; Oncoprotein; EC 2.7.11.1; EC 2.7.1.153; Kinase, lipid; Carbohydrate Metabolism - inositol phosphate

Chromosomal Location of Human Ortholog: 3q26.3

Cellular Component: lamellipodium; plasma membrane; phosphoinositide 3-kinase complex; cytosol

Molecular Function: protein serine/threonine kinase activity; protein binding; phosphatidylinositol-4,5-bisphosphate 3-kinase activity; insulin receptor substrate binding; 1-phosphatidylinositol-3-kinase activity; kinase activity; protein kinase activator activity; ATP binding; phosphatidylinositol-4-phosphate 3-kinase activity; phosphoinositide 3-kinase activity

Biological Process: epidermal growth factor receptor signaling pathway; platelet activation; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; nerve growth factor receptor signaling pathway; regulation of multicellular organism growth; glucose metabolic process; positive regulation of peptidyl-serine phosphorylation; T cell receptor signaling pathway; protein amino acid phosphorylation; vasculature development; phosphoinositide phosphorylation; positive regulation of protein kinase activity; phospholipid metabolic process; T cell costimulation; phosphatidylinositol biosynthetic process; protein kinase B signaling cascade; insulin receptor signaling pathway; innate immune response; endothelial cell migration; negative regulation of neuron apoptosis; angiogenesis; blood coagulation; vascular endothelial growth factor receptor signaling pathway; leukocyte migration; cardiac muscle contraction

Disease: Cowden Syndrome 5; Gastric Cancer; Keratosis, Seborrheic; Breast Cancer; Lung Cancer; Ovarian Cancer; Congenital Lipomatous Overgrowth, Vascular Malformations, And Epidermal Nevi; Colorectal Cancer; Megalencephaly-capillary Malformation-polymicrogyria Syndrome; Hepatocellular Carcinoma; Nevus, Epidermal

Similar Products

Product Notes

The PIK3CA pik3ca (Catalog #AAA6148864) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PIK3CA (Phosphatidylinositol-4,5-bisphosphate 3-kinase Catalytic Subunit alpha Isoform, PtdIns-3-kinase Subunit alpha, PI3-kinase Subunit alpha, PI3K-alpha, Phosphatidylinositol-4,5-bisphosphate 3-kinase 110kD Catalytic Subunit alpha, PtdIns-3-kinase Subu reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PIK3CA can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PIK3CA pik3ca for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PIK3CA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.