Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ADCYAP1R1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

Rabbit ADCYAP1R1 Polyclonal Antibody | anti-ADCYAP1R1 antibody

ADCYAP1R1 antibody - C-terminal region

Gene Names
ADCYAP1R1; PAC1; PAC1R; PACAPR; PACAPRI
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
ADCYAP1R1; Polyclonal Antibody; ADCYAP1R1 antibody - C-terminal region; anti-ADCYAP1R1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NESSIYLRLARSTLLLIPLFGIHYTVFAFSPENVSKRERLVFELGLGSFQ
Sequence Length
468
Applicable Applications for anti-ADCYAP1R1 antibody
Western Blot (WB), Immunohistochemistry (IHC)-F
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ADCYAP1R1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ADCYAP1R1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-ADCYAP1R1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)
Related Product Information for anti-ADCYAP1R1 antibody
This is a rabbit polyclonal antibody against ADCYAP1R1. It was validated on Western Blot

Target Description: This gene encodes type I adenylate cyclase activating polypeptide receptor, which is a membrane-associated protein and shares significant homology with members of the glucagon/secretin receptor family. This receptor mediates diverse biological actions of adenylate cyclase activating polypeptide 1 and is positively coupled to adenylate cyclase. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified.
Product Categories/Family for anti-ADCYAP1R1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
117
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
Pituitary adenylate cyclase-activating polypeptide type I receptor
NCBI Official Synonym Full Names
ADCYAP receptor type I
NCBI Official Symbol
ADCYAP1R1
NCBI Official Synonym Symbols
PAC1; PAC1R; PACAPR; PACAPRI
NCBI Protein Information
pituitary adenylate cyclase-activating polypeptide type I receptor
UniProt Protein Name
Pituitary adenylate cyclase-activating polypeptide type I receptor
UniProt Gene Name
ADCYAP1R1
UniProt Synonym Gene Names
PACAP type I receptor; PACAP-R-1; PACAP-R1
UniProt Entry Name
PACR_HUMAN

NCBI Description

This gene encodes type I adenylate cyclase activating polypeptide receptor, which is a membrane-associated protein and shares significant homology with members of the glucagon/secretin receptor family. This receptor mediates diverse biological actions of adenylate cyclase activating polypeptide 1 and is positively coupled to adenylate cyclase. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Dec 2010]

Uniprot Description

ADCYAP1R1: This is a receptor for PACAP-27 and PACAP-38. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. May regulate the release of adrenocorticotropin, luteinizing hormone, growth hormone, prolactin, epinephrine, and catecholamine. May play a role in spermatogenesis and sperm motility. Causes smooth muscle relaxation and secretion in the gastrointestinal tract. Belongs to the G-protein coupled receptor 2 family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, GPCR; Membrane protein, multi-pass; GPCR, family 2; Membrane protein, integral

Chromosomal Location of Human Ortholog: 7p14

Cellular Component: neuron projection; cell surface; tight junction; rough endoplasmic reticulum; integral to plasma membrane; plasma membrane; caveola; receptor complex; endosome

Molecular Function: ADP-ribosylation factor binding; neuropeptide binding; vasoactive intestinal polypeptide receptor activity; protein binding; receptor activity; adenylate cyclase binding

Biological Process: response to drug; G-protein coupled receptor protein signaling pathway; development of primary female sexual characteristics; cAMP-mediated signaling; response to ethanol; cell surface receptor linked signal transduction; nerve growth factor receptor signaling pathway; phospholipase C activation; adenylate cyclase activation; spermatogenesis; cell differentiation; multicellular organismal response to stress; response to estradiol stimulus; transmembrane receptor protein tyrosine kinase signaling pathway

Research Articles on ADCYAP1R1

Similar Products

Product Notes

The ADCYAP1R1 adcyap1r1 (Catalog #AAA3214580) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADCYAP1R1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ADCYAP1R1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC)-F. Researchers should empirically determine the suitability of the ADCYAP1R1 adcyap1r1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NESSIYLRLA RSTLLLIPLF GIHYTVFAFS PENVSKRERL VFELGLGSFQ. It is sometimes possible for the material contained within the vial of "ADCYAP1R1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.