Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.78kD).)

Mouse anti-Human DNAJC19 Monoclonal Antibody | anti-DNAJC19 antibody

DNAJC19 (Mitochondrial Import Inner Membrane Translocase Subunit TIM14, DnaJ Homolog Subfamily C Member 19, TIMM14, TIM14) (HRP)

Gene Names
DNAJC19; PAM18; TIM14; TIMM14
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DNAJC19; Monoclonal Antibody; DNAJC19 (Mitochondrial Import Inner Membrane Translocase Subunit TIM14; DnaJ Homolog Subfamily C Member 19; TIMM14; TIM14) (HRP); anti-DNAJC19 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3H4
Specificity
Recognizes human DNAJC19.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-DNAJC19 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa20-117 from human DNAJC19 (NP_660304) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.78kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.78kD).)

Testing Data

(Detection limit for recombinant GST tagged DNAJC19 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DNAJC19 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-DNAJC19 antibody
Probable component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity.
Product Categories/Family for anti-DNAJC19 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15.1 kDa (135aa), confirmed by MALDI-TOF
NCBI Official Full Name
mitochondrial import inner membrane translocase subunit TIM14 isoform 1
NCBI Official Synonym Full Names
DnaJ heat shock protein family (Hsp40) member C19
NCBI Official Symbol
DNAJC19
NCBI Official Synonym Symbols
PAM18; TIM14; TIMM14
NCBI Protein Information
mitochondrial import inner membrane translocase subunit TIM14
UniProt Protein Name
Mitochondrial import inner membrane translocase subunit TIM14
UniProt Gene Name
DNAJC19
UniProt Synonym Gene Names
TIM14; TIMM14
UniProt Entry Name
TIM14_HUMAN

NCBI Description

The protein encoded by this gene is thought to be part of a complex involved in the ATP-dependent transport of transit peptide-containing proteins from the inner cell membrane to the mitochondrial matrix. Defects in this gene are a cause of 3-methylglutaconic aciduria type 5 (MGA5), also known as dilated cardiomyopathy with ataxia (DCMA). Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1, 2, 6, 10, 14 and 19. [provided by RefSeq, Jan 2012]

Uniprot Description

DNAJC19: Probable component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity. Defects in DNAJC19 are the cause of 3-methylglutaconic aciduria type 5 (MGA5); also known as dilated cardiomyopathy with ataxia (DCMA). MGA5 is an autosomal recessive disorder characterized by early-onset dilated cardiomyopathy, growth failure, cerebellar ataxia causing significant motor delays, testicular dysgenesis, growth failure, and significant increases in urine organic acids, particularly 3-methylglutaconic acid and 3-methylglutaric acid. Belongs to the TIM14 family.

Protein type: Chaperone; Mitochondrial; Membrane protein, integral

Chromosomal Location of Human Ortholog: 3q26.33

Cellular Component: protein complex; mitochondrion; mitochondrial inner membrane; integral to membrane

Molecular Function: protein binding

Biological Process: genitalia development; cellular protein metabolic process; visual perception; protein folding; protein targeting to mitochondrion

Disease: 3-methylglutaconic Aciduria, Type V

Research Articles on DNAJC19

Similar Products

Product Notes

The DNAJC19 dnajc19 (Catalog #AAA6152188) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DNAJC19 (Mitochondrial Import Inner Membrane Translocase Subunit TIM14, DnaJ Homolog Subfamily C Member 19, TIMM14, TIM14) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DNAJC19 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DNAJC19 dnajc19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DNAJC19, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.