Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (RFNG monoclonal antibody, Western Blot analysis of RFNG expression in HepG2.)

Mouse anti-Human RFNG Monoclonal Antibody | anti-RFNG antibody

RFNG (Beta-1,3-N-acetylglucosaminyltransferase Radical Fringe, O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase)

Reactivity
Human
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
RFNG; Monoclonal Antibody; RFNG (Beta-1; 3-N-acetylglucosaminyltransferase Radical Fringe; O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase); Anti -RFNG (Beta-1; anti-RFNG antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6C7
Specificity
Recognizes human RFNG.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
LGSFMSTAEQVRLPDDCTVGYIVEGLLGARLLHSPLFHSHLENLQRLPPDTLLQQVTLSHGGPENPQNVVNVAGGFSLHQDPTRFKSIHCLLYPDTDWCPRQKQGAPTS
Applicable Applications for anti-RFNG antibody
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Partial recombinant corresponding to aa82-191, from human RFNG, from with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(RFNG monoclonal antibody, Western Blot analysis of RFNG expression in HepG2.)

Western Blot (WB) (RFNG monoclonal antibody, Western Blot analysis of RFNG expression in HepG2.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RFNG on HepG2 cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RFNG on HepG2 cell. [antibody concentration 10ug/ml])
Related Product Information for anti-RFNG antibody
The Drosophila melanogaster 'fringe' gene is a secreted signaling protein that is involved in the formation of boundaries between groups of cells during development. It acts by modulating the activation of te Notch signal transduction pathway. A human radical fringe homolog was identified in 1997. There is evidence to show that radical fringe homolog may be involve in limb formation and in neurogenesis in humans. It is a glycosyltransferase that initiates the elongation of O-linked fucose residues attached to EGF-like repeats in the extracellular domain of Notch molecules. It is a single-pass type II membrane protein which localises to the golgi apparatus membrane. It belongs to the glycosyltransferase 31 family.
Product Categories/Family for anti-RFNG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
36,424 Da
NCBI Official Full Name
RFNG protein
NCBI Official Synonym Full Names
RFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
NCBI Official Symbol
RFNG
NCBI Protein Information
beta-1,3-N-acetylglucosaminyltransferase radical fringe; radical fringe homolog; O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
UniProt Protein Name
Beta-1,3-N-acetylglucosaminyltransferase radical fringe
UniProt Gene Name
RFNG
UniProt Entry Name
RFNG_HUMAN

Uniprot Description

RFNG: Glycosyltransferase that initiates the elongation of O- linked fucose residues attached to EGF-like repeats in the extracellular domain of Notch molecules. May be involved in limb formation and in neurogenesis. Belongs to the glycosyltransferase 31 family.

Protein type: Membrane protein, integral; Motility/polarity/chemotaxis; EC 2.4.1.222; Transferase

Chromosomal Location of Human Ortholog: 17q25

Cellular Component: extracellular region; integral to Golgi membrane

Molecular Function: metal ion binding; O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase activity

Biological Process: nervous system development; organ morphogenesis; positive regulation of protein binding; metabolic process; cell differentiation; pattern specification process; positive regulation of Notch signaling pathway

Similar Products

Product Notes

The RFNG rfng (Catalog #AAA6000899) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RFNG (Beta-1,3-N-acetylglucosaminyltransferase Radical Fringe, O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RFNG can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the RFNG rfng for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LGSFMSTAEQ VRLPDDCTVG YIVEGLLGAR LLHSPLFHSH LENLQRLPPD TLLQQVTLSH GGPENPQNVV NVAGGFSLHQ DPTRFKSIHC LLYPDTDWCP RQKQGAPTS. It is sometimes possible for the material contained within the vial of "RFNG, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.