Mouse anti-Human DNAJC19 Monoclonal Antibody | anti-Dnajc19 antibody

DNAJC19 (Mitochondrial Import Inner Membrane Translocase Subunit TIM14, DnaJ Homolog Subfamily C Member 19, TIMM14, TIM14)

Cat. Num. AAA6004596

• Gene Names: Dnajc19; Tim14; AA959924; 1810055D05Rik
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: DNAJC19; Monoclonal Antibody; DNAJC19 (Mitochondrial Import Inner Membrane Translocase Subunit TIM14; DnaJ Homolog Subfamily C Member 19; TIMM14; TIM14); Anti -DNAJC19 (Mitochondrial Import Inner Membrane Translocase Subunit TIM14; anti-Dnajc19 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3H4
• Specificity: Recognizes human DNAJC19.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: RYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK

• Applicable Applications for anti-Dnajc19 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant protein corresponding to aa20-117 from human DNAJC19 (NP_660304) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.78kD).)

Testing Data

(Detection limit for recombinant GST tagged DNAJC19 is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-Dnajc19 antibody

Probable component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity.

Product Categories/Family for anti-Dnajc19 antibody

Antibodies; Abs to Transport Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 19353866
• NCBI GeneID: 67713
• UniProt Accession #: Q9CQV7; Q8R1N1; Q9D896
• Molecular Weight: 12,437 Da
• NCBI Official Full Name: Dnajc19 protein
• NCBI Official Synonym Full Names: DnaJ (Hsp40) homolog, subfamily C, member 19
• NCBI Official Symbol: Dnajc19
• NCBI Official Synonym Symbols: Tim14; AA959924; 1810055D05Rik
• NCBI Protein Information: mitochondrial import inner membrane translocase subunit TIM14; dnaJ homolog subfamily C member 19
• UniProt Protein Name: Mitochondrial import inner membrane translocase subunit TIM14
• UniProt Gene Name: Dnajc19
• UniProt Synonym Gene Names: Tim14; Timm14
• UniProt Entry Name: TIM14_MOUSE

Uniprot Description

DNAJC19: Probable component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity. Defects in DNAJC19 are the cause of 3-methylglutaconic aciduria type 5 (MGA5); also known as dilated cardiomyopathy with ataxia (DCMA). MGA5 is an autosomal recessive disorder characterized by early-onset dilated cardiomyopathy, growth failure, cerebellar ataxia causing significant motor delays, testicular dysgenesis, growth failure, and significant increases in urine organic acids, particularly 3-methylglutaconic acid and 3-methylglutaric acid. Belongs to the TIM14 family.

Protein type: Membrane protein, integral; Mitochondrial; Chaperone

Cellular Component: protein complex; mitochondrion; mitochondrial inner membrane

Biological Process: genitalia development; visual perception