Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human MEKK1 Monoclonal Antibody | anti-MEKK1 antibody

MEKK1 (MAPK/ERK Kinase Kinase 1, MEK Kinase 1, MEKK 1, MEKK1, MEKK, Mitogen-activated Protein Kinase Kinase Kinase 1, MAP3K1, MAPKKK1, SRXY6) (FITC)

Gene Names
MAP3K1; MEKK; MEKK1; SRXY6; MEKK 1; MAPKKK1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MEKK1; Monoclonal Antibody; MEKK1 (MAPK/ERK Kinase Kinase 1; MEK Kinase 1; MEKK 1; MEKK; Mitogen-activated Protein Kinase Kinase Kinase 1; MAP3K1; MAPKKK1; SRXY6) (FITC); anti-MEKK1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F6
Specificity
Recognizes human MAP3K1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-MEKK1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1211-1310 from human MAP3K1 (XP_042066) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTPVEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Testing Data

(Detection limit for recombinant GST tagged MAP3K1 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MAP3K1 is ~0.03ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis of protein-protein interactions between MAPK3 and MAP3K1 HeLa cells were stained with anti-MAPK3 rabbit purified polyclonal 1:1200 and anti-MAP3K1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Testing Data (Proximity Ligation Analysis of protein-protein interactions between MAPK3 and MAP3K1 HeLa cells were stained with anti-MAPK3 rabbit purified polyclonal 1:1200 and anti-MAP3K1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)
Related Product Information for anti-MEKK1 antibody
MEKK1, a MAP3K type protein kinase, is a member of the stress-activated protein kinase (SAPK) pathways which convey pro-apoptotic signals. The protein consists of a C-terminal protein kinase domain and an extensive N-terminal domain that includes two proline-rich segments containing putative binding sites for proteins with SH3 domains, a consensus binding site for 14-3-3 proteins, two PH domains and an acid rich motif with two sites for cleavage by proapoptotic caspase cysteine proteases. MEKK1 activates MKK4/MAP2K4 and, to a lesser extent, MKK7/MAP2K7 in the SAPK cascade. MEKK1 also has been shown to activate the transcription factor CCAAT/enhancer-binding protein-beta-dependent gene expression via MEK1-ERK1/2 kinases in response to IFN-gamma. In MEKK1 (-/-) mouse embryonic stem cells the response of JNK to microtubule disruption, cold stress, hyperosmolarity and serum factors is lost or altered, and the response of ERK to hyperosmolarity and serum factors is diminished.
Product Categories/Family for anti-MEKK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Synonym Full Names
mitogen-activated protein kinase kinase kinase 1
NCBI Official Symbol
MAP3K1
NCBI Official Synonym Symbols
MEKK; MEKK1; SRXY6; MEKK 1; MAPKKK1
NCBI Protein Information
mitogen-activated protein kinase kinase kinase 1

NCBI Description

The protein encoded by this gene is a serine/threonine kinase and is part of some signal transduction cascades, including the ERK and JNK kinase pathways as well as the NF-kappa-B pathway. The encoded protein is activated by autophosphorylation and requires magnesium as a cofactor in phosphorylating other proteins. This protein has E3 ligase activity conferred by a plant homeodomain (PHD) in its N-terminus and phospho-kinase activity conferred by a kinase domain in its C-terminus. [provided by RefSeq, Mar 2012]

Research Articles on MEKK1

Similar Products

Product Notes

The MEKK1 (Catalog #AAA6148191) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MEKK1 (MAPK/ERK Kinase Kinase 1, MEK Kinase 1, MEKK 1, MEKK1, MEKK, Mitogen-activated Protein Kinase Kinase Kinase 1, MAP3K1, MAPKKK1, SRXY6) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MEKK1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MEKK1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MEKK1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.