Mouse anti-Human MEKK1 Monoclonal Antibody | anti-MEKK1 antibody

MEKK1 (MAPK/ERK Kinase Kinase 1, MEK Kinase 1, MEKK 1, MEKK1, MEKK, Mitogen-activated Protein Kinase Kinase Kinase 1, MAP3K1, MAPKKK1, SRXY6) (Biotin)

Cat. Num. AAA6142888

• Gene Names: MAP3K1; MEKK; MEKK1; SRXY6; MEKK 1; MAPKKK1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MEKK1; Monoclonal Antibody; MEKK1 (MAPK/ERK Kinase Kinase 1; MEK Kinase 1; MEKK 1; MEKK; Mitogen-activated Protein Kinase Kinase Kinase 1; MAP3K1; MAPKKK1; SRXY6) (Biotin); anti-MEKK1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2F6
• Specificity: Recognizes human MAP3K1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-MEKK1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1211-1310 from human MAP3K1 (XP_042066) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTPVEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Testing Data

(Detection limit for recombinant GST tagged MAP3K1 is ~0.03ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis of protein-protein interactions between MAPK3 and MAP3K1 HeLa cells were stained with anti-MAPK3 rabbit purified polyclonal 1:1200 and anti-MAP3K1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Related Product Information for anti-MEKK1 antibody

MEKK1, a MAP3K type protein kinase, is a member of the stress-activated protein kinase (SAPK) pathways which convey pro-apoptotic signals. The protein consists of a C-terminal protein kinase domain and an extensive N-terminal domain that includes two proline-rich segments containing putative binding sites for proteins with SH3 domains, a consensus binding site for 14-3-3 proteins, two PH domains and an acid rich motif with two sites for cleavage by proapoptotic caspase cysteine proteases. MEKK1 activates MKK4/MAP2K4 and, to a lesser extent, MKK7/MAP2K7 in the SAPK cascade. MEKK1 also has been shown to activate the transcription factor CCAAT/enhancer-binding protein-beta-dependent gene expression via MEK1-ERK1/2 kinases in response to IFN-gamma. In MEKK1 (-/-) mouse embryonic stem cells the response of JNK to microtubule disruption, cold stress, hyperosmolarity and serum factors is lost or altered, and the response of ERK to hyperosmolarity and serum factors is diminished.

Product Categories/Family for anti-MEKK1 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 113416541
• NCBI GeneID: 4214
• UniProt Accession #: NM_005921; Q13233
• NCBI Official Synonym Full Names: mitogen-activated protein kinase kinase kinase 1
• NCBI Official Symbol: MAP3K1
• NCBI Official Synonym Symbols: MEKK; MEKK1; SRXY6; MEKK 1; MAPKKK1
• NCBI Protein Information: mitogen-activated protein kinase kinase kinase 1
• Protein Family: Mitogen-activated protein kinase kinase kinase

NCBI Description

The protein encoded by this gene is a serine/threonine kinase and is part of some signal transduction cascades, including the ERK and JNK kinase pathways as well as the NF-kappa-B pathway. The encoded protein is activated by autophosphorylation and requires magnesium as a cofactor in phosphorylating other proteins. This protein has E3 ligase activity conferred by a plant homeodomain (PHD) in its N-terminus and phospho-kinase activity conferred by a kinase domain in its C-terminus. [provided by RefSeq, Mar 2012]