Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (91.45kD).)

Mouse anti-Human GLMN Monoclonal Antibody | anti-GLMN antibody

GLMN (FAP48, FAP68, VMGLOM, Glomulin, FK506-binding Protein-associated Protein, FAP, FKBP-associated Protein) (FITC)

Gene Names
GLMN; FAP; GVM; GLML; FAP48; FAP68; FKBPAP; VMGLOM
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GLMN; Monoclonal Antibody; GLMN (FAP48; FAP68; VMGLOM; Glomulin; FK506-binding Protein-associated Protein; FAP; FKBP-associated Protein) (FITC); anti-GLMN antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1C12
Specificity
Recognizes human GLMN.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
1922
Applicable Applications for anti-GLMN antibody
ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IF: 20ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-595 from GLMN (AAH01257) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAVEELQSIIKRCQILEEQDFKEEDFGLFQLAGQRCIEEGHTDQLLEIIQNEKNKVIIKNMGWNLVGPVVRCLLCKDKEDSKRKVYFLIFDLLVKLCNPKELLLGLLELIEEPSGKQISQSILLLLQPLQTVIQKLHNKAYSIGLALSTLWNQLSLLPVPYSKEQIQMDDYGLCQCCKALIEFTKPFVEEVIDNKENSLENEKLKDELLKFCFKSLKCPLLTAQFFEQSEEGGNDPFRYFASEIIGFLSAIGHPF
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (91.45kD).)

Western Blot (WB) (Western Blot detection against Immunogen (91.45kD).)

Western Blot (WB)

(Western Blot analysis of GLMN expression in transfected 293T cell line by GLMN monoclonal antibody. Lane 1: GLMN transfected lysate (68.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GLMN expression in transfected 293T cell line by GLMN monoclonal antibody. Lane 1: GLMN transfected lysate (68.2kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to GLMN on HeLa cell. [antibody concentration 20ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to GLMN on HeLa cell. [antibody concentration 20ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of GLMN transfected lysate using GLMN monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GLMN rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of GLMN transfected lysate using GLMN monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GLMN rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged GLMN is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GLMN is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(GLMN monoclonal antibody Western Blot analysis of GLMN expression in Jurkat.)

Western Blot (WB) (GLMN monoclonal antibody Western Blot analysis of GLMN expression in Jurkat.)

Western Blot (WB)

(GLMN monoclonal antibody Western Blot analysis of GLMN expression in HL-60.)

Western Blot (WB) (GLMN monoclonal antibody Western Blot analysis of GLMN expression in HL-60.)
Product Categories/Family for anti-GLMN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens glomulin, FKBP associated protein, mRNA
NCBI Official Synonym Full Names
glomulin, FKBP associated protein
NCBI Official Symbol
GLMN
NCBI Official Synonym Symbols
FAP; GVM; GLML; FAP48; FAP68; FKBPAP; VMGLOM
NCBI Protein Information
glomulin
Protein Family

NCBI Description

This gene encodes a phosphorylated protein that is a member of a Skp1-Cullin-F-box-like complex. The protein is essential for normal development of the vasculature and mutations in this gene have been associated with glomuvenous malformations, also called glomangiomas. Multiple splice variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016]

Research Articles on GLMN

Similar Products

Product Notes

The GLMN (Catalog #AAA6147387) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GLMN (FAP48, FAP68, VMGLOM, Glomulin, FK506-binding Protein-associated Protein, FAP, FKBP-associated Protein) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GLMN can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB). IF: 20ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GLMN for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GLMN, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.