Mouse anti-Human GLMN Monoclonal Antibody | anti-GLMN antibody

GLMN (FAP48, FAP68, VMGLOM, Glomulin, FK506-binding Protein-associated Protein, FAP, FKBP-associated Protein) (Biotin)

Cat. Num. AAA6142084

• Gene Names: GLMN; FAP; GVM; GLML; FAP48; FAP68; FKBPAP; VMGLOM
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GLMN; Monoclonal Antibody; GLMN (FAP48; FAP68; VMGLOM; Glomulin; FK506-binding Protein-associated Protein; FAP; FKBP-associated Protein) (Biotin); anti-GLMN antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1C12
• Specificity: Recognizes human GLMN.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 1922

• Applicable Applications for anti-GLMN antibody: ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IF: 20ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-595 from GLMN (AAH01257) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAVEELQSIIKRCQILEEQDFKEEDFGLFQLAGQRCIEEGHTDQLLEIIQNEKNKVIIKNMGWNLVGPVVRCLLCKDKEDSKRKVYFLIFDLLVKLCNPKELLLGLLELIEEPSGKQISQSILLLLQPLQTVIQKLHNKAYSIGLALSTLWNQLSLLPVPYSKEQIQMDDYGLCQCCKALIEFTKPFVEEVIDNKENSLENEKLKDELLKFCFKSLKCPLLTAQFFEQSEEGGNDPFRYFASEIIGFLSAIGHPF
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (91.45kD).)

Western Blot (WB)

(Western Blot analysis of GLMN expression in transfected 293T cell line by GLMN monoclonal antibody. Lane 1: GLMN transfected lysate (68.2kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to GLMN on HeLa cell. [antibody concentration 20ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of GLMN transfected lysate using GLMN monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GLMN rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged GLMN is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(GLMN monoclonal antibody Western Blot analysis of GLMN expression in Jurkat.)

Western Blot (WB)

(GLMN monoclonal antibody Western Blot analysis of GLMN expression in HL-60.)

Product Categories/Family for anti-GLMN antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 12654828
• NCBI GeneID: 11146
• NCBI Official Full Name: Homo sapiens glomulin, FKBP associated protein, mRNA
• NCBI Official Synonym Full Names: glomulin, FKBP associated protein
• NCBI Official Symbol: GLMN
• NCBI Official Synonym Symbols: FAP; GVM; GLML; FAP48; FAP68; FKBPAP; VMGLOM
• NCBI Protein Information: glomulin
• Protein Family: Glomulin

NCBI Description

This gene encodes a phosphorylated protein that is a member of a Skp1-Cullin-F-box-like complex. The protein is essential for normal development of the vasculature and mutations in this gene have been associated with glomuvenous malformations, also called glomangiomas. Multiple splice variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016]