Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged C1QBP is ~0.03ng/ml as a capture antibody)

Mouse anti-Human GC1qR Monoclonal Antibody | anti-GC1qR antibody

GC1qR (Complement Component 1 Q Subcomponent-binding Protein Mitochondrial, Glycoprotein gC1qBP, C1qBP, GC1q-R Protein, GC1QBP, Hyaluronan-binding Protein 1, HABP1, Mitochondrial Matrix Protein p32, p33, SF2P32) (FITC)

Gene Names
C1QBP; p32; HABP1; gC1qR; GC1QBP; SF2p32; gC1Q-R; COXPD33
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GC1qR; Monoclonal Antibody; GC1qR (Complement Component 1 Q Subcomponent-binding Protein Mitochondrial; Glycoprotein gC1qBP; C1qBP; GC1q-R Protein; GC1QBP; Hyaluronan-binding Protein 1; HABP1; Mitochondrial Matrix Protein p32; p33; SF2P32) (FITC); anti-GC1qR antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1F3
Specificity
Recognizes human C1QBP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-GC1qR antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa173-282 from human C1QBP (NP_001203) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged C1QBP is ~0.03ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged C1QBP is ~0.03ng/ml as a capture antibody)
Related Product Information for anti-GC1qR antibody
The human complement subcomponent C1q associates with C1r and C1s in order to yield the first component of the serum complement system. C1QBP is known to bind to the globular heads of C1q molecules and inhibit C1 activation. This protein has also been identified as the p32 subunit of pre-mRNA splicing factor SF2, as well as a hyaluronic acid-binding protein.
Product Categories/Family for anti-GC1qR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
708
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,362 Da
NCBI Official Full Name
complement component 1 Q subcomponent-binding protein, mitochondrial
NCBI Official Synonym Full Names
complement C1q binding protein
NCBI Official Symbol
C1QBP
NCBI Official Synonym Symbols
p32; HABP1; gC1qR; GC1QBP; SF2p32; gC1Q-R; COXPD33
NCBI Protein Information
complement component 1 Q subcomponent-binding protein, mitochondrial
UniProt Protein Name
Complement component 1 Q subcomponent-binding protein, mitochondrial
UniProt Gene Name
C1QBP
UniProt Synonym Gene Names
GC1QBP; HABP1; SF2P32; C1qBP
UniProt Entry Name
C1QBP_HUMAN

NCBI Description

The human complement subcomponent C1q associates with C1r and C1s in order to yield the first component of the serum complement system. The protein encoded by this gene is known to bind to the globular heads of C1q molecules and inhibit C1 activation. This protein has also been identified as the p32 subunit of pre-mRNA splicing factor SF2, as well as a hyaluronic acid-binding protein. [provided by RefSeq, Jul 2008]

Uniprot Description

C1QBP: a multifunctional and multicompartmental protein involved in inflammation and infection processes, ribosome biogenesis, regulation of apoptosis, transcriptional regulation and pre-mRNA splicing. Originally identified via its binding interactions with Splicing Factor (SF-2). Multiple, diverse binding partners of C1QBP were subsequently identified, including the globular heads of complement component C1q, hyaluronic acid, selected protein kinases, the tumor suppressor ARF, and multiple antigens of bacterial and viral origin. Overexpressed in a number of cancer cell types, and has been implicated in the Warburg effect, whereby cancer cells shift their metabolism from oxidative phosphorylation to glycolysis. Inhibits the Mitochondrial Permeability Transition (MPT) pore, possibly serving a protective function against damage from oxidative stress. Binding to C1q inhibits C1. In complex with cytokeratin-1/KRT1 is a high affinty receptor for kininogen-1/HMWK. The secreted form may enhance both extrinsic and intrinsic coagulation pathways. The cell surface form may require docking with transmembrane proteins for downstream signaling which might be specific for a cell-type or response. Belongs to the MAM33 family.

Protein type: Motility/polarity/chemotaxis; Receptor, misc.; Nucleolus; Mitochondrial

Chromosomal Location of Human Ortholog: 17p13.3

Cellular Component: extracellular space; cell surface; mitochondrion; membrane; mitochondrial matrix; cytoplasm; plasma membrane; nucleolus; cytosol; nucleus

Molecular Function: mRNA binding; protein binding; adrenergic receptor binding; protein kinase C binding; complement component C1q binding; hyaluronic acid binding; kininogen binding; transcription factor binding; transcription corepressor activity

Biological Process: negative regulation of interleukin-12 production; phosphoinositide 3-kinase cascade; positive regulation of cell adhesion; viral reproduction; transcription, DNA-dependent; apoptosis; positive regulation of apoptosis; RNA splicing; negative regulation of defense response to virus; negative regulation of transcription from RNA polymerase II promoter; positive regulation of protein kinase B signaling cascade; negative regulation of nuclear mRNA splicing, via spliceosome; negative regulation of interferon-gamma production; regulation of complement activation; innate immune response; immune response; blood coagulation; mRNA processing; blood coagulation, intrinsic pathway; complement activation, classical pathway; mature ribosome assembly

Research Articles on GC1qR

Similar Products

Product Notes

The GC1qR c1qbp (Catalog #AAA6147343) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GC1qR (Complement Component 1 Q Subcomponent-binding Protein Mitochondrial, Glycoprotein gC1qBP, C1qBP, GC1q-R Protein, GC1QBP, Hyaluronan-binding Protein 1, HABP1, Mitochondrial Matrix Protein p32, p33, SF2P32) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GC1qR can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GC1qR c1qbp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GC1qR, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.