Testing Data
(Detection limit for recombinant GST tagged C1QBP is ~0.03ng/ml as a capture antibody)
Mouse anti-Human GC1qR Monoclonal Antibody
GC1qR (Complement Component 1 Q Subcomponent-binding Protein Mitochondrial, Glycoprotein gC1qBP, C1qBP, GC1q-R Protein, GC1QBP, Hyaluronan-binding Protein 1, HABP1, Mitochondrial Matrix Protein p32, p33, SF2P32)
Reactivity
Human
Applications
ELISA
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
GC1qR; Monoclonal Antibody; GC1qR (Complement Component 1 Q Subcomponent-binding Protein Mitochondrial; Glycoprotein gC1qBP; C1qBP; GC1q-R Protein; GC1QBP; Hyaluronan-binding Protein 1; HABP1; Mitochondrial Matrix Protein p32; p33; SF2P32); Anti -GC1qR (Complement Component 1 Q Subcomponent-binding Protein Mitochondrial; anti-GC1qR antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1F3
Specificity
Recognizes human C1QBP.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
IKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ
Applicable Applications for anti-GC1qR antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Partial recombinant corresponding to aa173-282 from human C1QBP (NP_001203) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged C1QBP is ~0.03ng/ml as a capture antibody)
Testing Data
(Detection limit for recombinant GST tagged C1QBP is ~0.03ng/ml as a capture antibody)
Related Product Information for anti-GC1qR antibody
The human complement subcomponent C1q associates with C1r and C1s in order to yield the first component of the serum complement system. C1QBP is known to bind to the globular heads of C1q molecules and inhibit C1 activation. This protein has also been identified as the p32 subunit of pre-mRNA splicing factor SF2, as well as a hyaluronic acid-binding protein.
Product Categories/Family for anti-GC1qR antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Official Full Name
gC1qR
Similar Products
Product Notes
The GC1qR (Catalog #AAA645827) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GC1qR (Complement Component 1 Q Subcomponent-binding Protein Mitochondrial, Glycoprotein gC1qBP, C1qBP, GC1q-R Protein, GC1QBP, Hyaluronan-binding Protein 1, HABP1, Mitochondrial Matrix Protein p32, p33, SF2P32) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GC1qR can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the GC1qR for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IKNDDGKKAL VLDCHYPEDE VGQEDEAESD IFSIREVSFQ STGESEWKDT NYTLNTDSLD WALYDHLMDF LADRGVDNTF ADELVELSTA LEHQEYITFL EDLKSFVKSQ. It is sometimes possible for the material contained within the vial of "GC1qR, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
