Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CAPG Monoclonal Antibody | anti-CAPG antibody

CAPG (Capping Protein (actin filament), Gelsolin-like, AFCP, MCP, Actin-regulatory Protein CAP-G, Gelsolin-like Capping Protein, Macrophage Capping Protein) (Biotin)

Gene Names
CAPG; MCP; AFCP; HEL-S-66
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified
Synonyms
CAPG; Monoclonal Antibody; CAPG (Capping Protein (actin filament); Gelsolin-like; AFCP; MCP; Actin-regulatory Protein CAP-G; Gelsolin-like Capping Protein; Macrophage Capping Protein) (Biotin); anti-CAPG antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6D6
Specificity
Recognizes human CAPG.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
348
Applicable Applications for anti-CAPG antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Recombinant protein corresponding to aa249-348 from human CAPG with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AALYKVSDATGQMNLTKVADSSPFALELLISDDCFVLD NGLCGKIYIWKGRKANEKERQAALQVAEGFISRMQYA PNTQVEILPQGHESPIFKQFFKDWK
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-CAPG antibody
phosphoinositide-regulated manner, but does not sever preformed actin filaments. By capping the barbed ends of actin filaments, the encoded protein contributes to the control of actin-based motility in non-muscle cells. Alternatively spliced transcript variants have been observed, but have not been fully described.
Product Categories/Family for anti-CAPG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
822
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
macrophage-capping protein isoform 1
NCBI Official Synonym Full Names
capping actin protein, gelsolin like
NCBI Official Symbol
CAPG
NCBI Official Synonym Symbols
MCP; AFCP; HEL-S-66
NCBI Protein Information
macrophage-capping protein
UniProt Protein Name
Macrophage-capping protein
Protein Family
UniProt Gene Name
CAPG
UniProt Synonym Gene Names
AFCP; MCP
UniProt Entry Name
CAPG_HUMAN

NCBI Description

This gene encodes a member of the gelsolin/villin family of actin-regulatory proteins. The encoded protein reversibly blocks the barbed ends of F-actin filaments in a Ca2+ and phosphoinositide-regulated manner, but does not sever preformed actin filaments. By capping the barbed ends of actin filaments, the encoded protein contributes to the control of actin-based motility in non-muscle cells. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jan 2012]

Uniprot Description

CAPG: Calcium-sensitive protein which reversibly blocks the barbed ends of actin filaments but does not sever preformed actin filaments. May play an important role in macrophage function. May play a role in regulating cytoplasmic and/or nuclear structures through potential interactions with actin. May bind DNA. Belongs to the villin/gelsolin family.

Protein type: Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 2p11.2

Cellular Component: F-actin capping protein complex; melanosome; nucleus

Molecular Function: actin binding

Biological Process: protein complex assembly; cell projection biogenesis; barbed-end actin filament capping

Research Articles on CAPG

Similar Products

Product Notes

The CAPG capg (Catalog #AAA6145365) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CAPG (Capping Protein (actin filament), Gelsolin-like, AFCP, MCP, Actin-regulatory Protein CAP-G, Gelsolin-like Capping Protein, Macrophage Capping Protein) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CAPG can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CAPG capg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CAPG, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.