Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.18kD).)

Mouse anti-Human DIAPH1 Monoclonal Antibody | anti-DIAPH1 antibody

DIAPH1 (Protein Diaphanous Homolog 1, Diaphanous-related Formin-1, DRF1, DIAP1) (Biotin)

Gene Names
DIAPH1; DIA1; DRF1; DFNA1; LFHL1; hDIA1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DIAPH1; Monoclonal Antibody; DIAPH1 (Protein Diaphanous Homolog 1; Diaphanous-related Formin-1; DRF1; DIAP1) (Biotin); anti-DIAPH1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
5A8
Specificity
Recognizes human DIAPH1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-DIAPH1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Sandwich ELISA: The detection limit is ~0.1ng/ml as a capture antibody
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa921-1024 from human DIAPH1 (NP_005210) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKAS
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.18kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.18kD).)

Testing Data

(Detection limit for recombinant GST tagged DIAPH1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DIAPH1 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-DIAPH1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
140,289 Da
NCBI Official Full Name
protein diaphanous homolog 1 isoform 1
NCBI Official Synonym Full Names
diaphanous-related formin 1
NCBI Official Symbol
DIAPH1
NCBI Official Synonym Symbols
DIA1; DRF1; DFNA1; LFHL1; hDIA1
NCBI Protein Information
protein diaphanous homolog 1; diaphanous-related formin-1
UniProt Protein Name
Protein diaphanous homolog 1
Protein Family
UniProt Gene Name
DIAPH1
UniProt Synonym Gene Names
DIAP1; DRF1

Uniprot Description

Acts in a Rho-dependent manner to recruit PFY1 to the membrane. Required for the assembly of F-actin structures, such as actin cables and stress fibers. Nucleates actin filaments. Binds to the barbed end of the actin filament and slows down actin polymerization and depolymerization. Required for cytokinesis, and transcriptional activation of the serum response factor. DFR proteins couple Rho and Src tyrosine kinase during signaling and the regulation of actin dynamics. Functions as a scaffold protein for MAPRE1 and APC to stabilize microtubules and promote cell migration (). Has neurite outgrowth promoting activity (). In hear cells, it may play a role in the regulation of actin polymerization in hair cells. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape (PubMed:20937854, PubMed:21834987). Plays a role in brain development (PubMed:24781755).

Similar Products

Product Notes

The DIAPH1 diaph1 (Catalog #AAA6141540) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DIAPH1 (Protein Diaphanous Homolog 1, Diaphanous-related Formin-1, DRF1, DIAP1) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DIAPH1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Sandwich ELISA: The detection limit is ~0.1ng/ml as a capture antibody Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DIAPH1 diaph1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DIAPH1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.