Mouse anti-Human DIAPH1 Monoclonal Antibody | anti-DIAPH1 antibody

DIAPH1 (Protein Diaphanous Homolog 1, Diaphanous-related Formin-1, DRF1, DIAP1) (FITC)

Cat. Num. AAA6146843

• Gene Names: DIAPH1; DIA1; DRF1; DFNA1; LFHL1; hDIA1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DIAPH1; Monoclonal Antibody; DIAPH1 (Protein Diaphanous Homolog 1; Diaphanous-related Formin-1; DRF1; DIAP1) (FITC); anti-DIAPH1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 5A8
• Specificity: Recognizes human DIAPH1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-DIAPH1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Sandwich ELISA: The detection limit is ~0.1ng/ml as a capture antibody; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa921-1024 from human DIAPH1 (NP_005210) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKAS
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.18kD).)

Testing Data

(Detection limit for recombinant GST tagged DIAPH1 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-DIAPH1 antibody

Antibodies; Disease Markers

NCBI and Uniprot Product Information

• NCBI GI #: 119395758
• NCBI GeneID: 1729
• NCBI Accession #: NP_005210
• NCBI GenBank Nucleotide #: NM_005219
• UniProt Accession #: O60610; Q17RN4; Q59FH8; Q9UC76; A6NF18; B7ZKW2; E9PEZ2
• Molecular Weight: 140,289 Da
• NCBI Official Full Name: protein diaphanous homolog 1 isoform 1
• NCBI Official Synonym Full Names: diaphanous-related formin 1
• NCBI Official Symbol: DIAPH1
• NCBI Official Synonym Symbols: DIA1; DRF1; DFNA1; LFHL1; hDIA1
• NCBI Protein Information: protein diaphanous homolog 1; diaphanous-related formin-1
• UniProt Protein Name: Protein diaphanous homolog 1
• Protein Family: Protein diaphanous
• UniProt Gene Name: DIAPH1
• UniProt Synonym Gene Names: DIAP1; DRF1

Uniprot Description

Acts in a Rho-dependent manner to recruit PFY1 to the membrane. Required for the assembly of F-actin structures, such as actin cables and stress fibers. Nucleates actin filaments. Binds to the barbed end of the actin filament and slows down actin polymerization and depolymerization. Required for cytokinesis, and transcriptional activation of the serum response factor. DFR proteins couple Rho and Src tyrosine kinase during signaling and the regulation of actin dynamics. Functions as a scaffold protein for MAPRE1 and APC to stabilize microtubules and promote cell migration (). Has neurite outgrowth promoting activity (). In hear cells, it may play a role in the regulation of actin polymerization in hair cells. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape (PubMed:20937854, PubMed:21834987). Plays a role in brain development (PubMed:24781755).