Mouse PML Monoclonal Antibody | anti-PML antibody

PML (promyelocytic Leukemia, MYL, PP8675, RNF71, TRIM19) (HRP)

Cat. Num. AAA6182509

• Gene Names: PML; MYL; RNF71; PP8675; TRIM19
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: PML; Monoclonal Antibody; PML (promyelocytic Leukemia; MYL; PP8675; RNF71; TRIM19) (HRP); promyelocytic Leukemia; TRIM19; anti-PML antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2B10
• Specificity: Recognizes PML.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 781

• Applicable Applications for anti-PML antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: PML (AAH00080, 411aa-510aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RDPIDVDLDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVV
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PML monoclonal antibody (M04), clone 2B10. Western Blot analysis of PML expression in HepG2.)

Testing Data

(Detection limit for recombinant GST tagged PML is 1 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PML on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PML on HeLa cell. [antibody concentration 10 ug/ml])

Product Categories/Family for anti-PML antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 33875197
• NCBI GeneID: 5371
• NCBI Official Full Name: Promyelocytic leukemia
• NCBI Official Synonym Full Names: PML nuclear body scaffold
• NCBI Official Symbol: PML
• NCBI Official Synonym Symbols: MYL; RNF71; PP8675; TRIM19
• NCBI Protein Information: protein PML
• Protein Family: Protein

NCBI Description

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions; all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]