Mouse anti-Human CLIC3 Monoclonal Antibody | anti-CLIC3 antibody

CLIC3 (Chloride Intracellular Channel Protein 3) (Biotin)

Cat. Num. AAA6141249

• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CLIC3; Monoclonal Antibody; CLIC3 (Chloride Intracellular Channel Protein 3) (Biotin); anti-CLIC3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3F8
• Specificity: Recognizes human CLIC3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-CLIC3 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IF: 15ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa137-237 from CLIC3 (NP_004660) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to CLIC3 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CLIC3 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CLIC3 on HeLa cell. [antibody concentration 15ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of CLIC3 transfected lysate using CLIC3 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with CLIC3 rabbit polyclonal antibod)

Testing Data

(Detection limit for recombinant GST tagged CLIC3 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-CLIC3 antibody

Antibodies; Ion Channel

NCBI and Uniprot Product Information

• NCBI GI #: 40288290
• NCBI GeneID: 9022
• NCBI Accession #: NP_004660
• NCBI GenBank Nucleotide #: NM_004669
• UniProt Accession #: O95833; Q5SPZ7
• Molecular Weight: 26,648 Da
• NCBI Official Full Name: chloride intracellular channel protein 3
• NCBI Official Synonym Full Names: chloride intracellular channel 3
• NCBI Official Symbol: CLIC3
• NCBI Protein Information: chloride intracellular channel protein 3
• UniProt Protein Name: Chloride intracellular channel protein 3
• Protein Family: Chloride intracellular channel protein
• UniProt Gene Name: CLIC3
• UniProt Entry Name: CLIC3_HUMAN

Uniprot Description

CLIC3: Can insert into membranes and form chloride ion channels. May participate in cellular growth control. Belongs to the chloride channel CLIC family.

Protein type: Membrane protein, integral; Channel, chloride

Chromosomal Location of Human Ortholog: 9q34.3

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; chloride channel activity; voltage-gated ion channel activity

Biological Process: chloride transport; signal transduction