Histone H2B type 1-M (Hist1h2bm) Recombinant Protein | Hist1h2bm recombinant protein

Recombinant Mouse Histone H2B type 1-M (Hist1h2bm)

Cat. Num. AAA961570

• Gene Names: Hist1h2bm; H2b-291b
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Histone H2B type 1-M (Hist1h2bm); Recombinant Mouse Histone H2B type 1-M (Hist1h2bm); H2B 291B; Hist1h2bm recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-126. Full length of the mature protein.
• Sequence: PEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
• Sequence Length: 126

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Hist1h2bm recombinant protein

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

References

Mouse histone H2A and H2B genes four functional genes and a pseudogene undergoing gene conversion with a closely linked functional gene.Liu T.-J., Liu L., Marzluff W.F.Nucleic Acids Res. 15:3023-3039(1987) The human and mouse replication-dependent histone genes.Marzluff W.F., Gongidi P., Woods K.R., Jin J., Maltais L.J.Genomics 80:487-498(2002) Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) Phosphorylation of histone H2B at DNA double-strand breaks.Fernandez-Capetillo O., Allis C.D., Nussenzweig A.J. Exp. Med. 199:1671-1677(2004) Histone modifications associated with somatic hypermutation.Odegard V.H., Kim S.T., Anderson S.M., Shlomchik M.J., Schatz D.G.Immunity 23:101-110(2005) Signaling kinase AMPK activates stress-promoted transcription via histone H2B phosphorylation.Bungard D., Fuerth B.J., Zeng P.Y., Faubert B., Maas N.L., Viollet B., Carling D., Thompson C.B., Jones R.G., Berger S.L.Science 329:1201-1205(2010) Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.Tan M., Luo H., Lee S., Jin F., Yang J.S., Montellier E., Buchou T., Cheng Z., Rousseaux S., Rajagopal N., Lu Z., Ye Z., Zhu Q., Wysocka J., Ye Y., Khochbin S., Ren B., Zhao Y.Cell 146:1016-1028(2011) SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013)

NCBI and Uniprot Product Information

• NCBI GI #: 30061385
• NCBI GeneID: 319186
• NCBI Accession #: NP_835507.1
• NCBI GenBank Nucleotide #: NM_178200.2
• UniProt Accession #: P10854; Q5T008
• Molecular Weight: 17.8 kDa
• NCBI Official Full Name: histone H2B type 1-M
• NCBI Official Synonym Full Names: histone cluster 1, H2bm
• NCBI Official Symbol: Hist1h2bm
• NCBI Official Synonym Symbols: H2b-291b
• NCBI Protein Information: histone H2B type 1-M
• UniProt Protein Name: Histone H2B type 1-M
• Protein Family: Histone
• UniProt Gene Name: Hist1h2bm
• UniProt Entry Name: H2B1M_MOUSE

NCBI Description

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2B family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. [provided by RefSeq, Aug 2015]

Uniprot Description

H2B1D: a core component of the nucleoosome. The nucleosome, a basic organizational unit of chromosomal DNA, is octrameric, consisting of two molecules each of histones H2B, H2A, H3, H4. The octamer wraps approximately 147 bp of DNA. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Interacts with acetylated H4 during chromatin remodeling. Binds to HIRA, a replication-dependent histone family member.

Protein type: DNA-binding

Cellular Component: chromosome; cytoplasm; nucleoplasm; nucleosome; nucleus

Molecular Function: DNA binding; protein heterodimerization activity

Biological Process: nucleosome assembly