Testing Data
(Detection limit for recombinant GST tagged CLIC3 is approximately 3ng/ml as a capture antibody.)
Mouse CLIC3 Monoclonal Antibody | anti-CLIC3 antibody
CLIC3 (Chloride Intracellular Channel 3) (FITC)
Applications
Western Blot
Purity
Purified
Synonyms
CLIC3; Monoclonal Antibody; CLIC3 (Chloride Intracellular Channel 3) (FITC); Chloride Intracellular Channel 3; anti-CLIC3 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2C5
Specificity
Recognizes CLIC3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-CLIC3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CLIC3 (NP_004660, 137aa-236aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.
FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged CLIC3 is approximately 3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged CLIC3 is approximately 3ng/ml as a capture antibody.)
Related Product Information for anti-CLIC3 antibody
Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 3 is a member of the p64 family and is predominantly localized in the nucleus and stimulates chloride ion channel activity. In addition, this protein may participate in cellular growth control, based on its association with ERK7, a member of the MAP kinase family. [provided by RefSeq]
Product Categories/Family for anti-CLIC3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
26,648 Da
NCBI Official Full Name
chloride intracellular channel protein 3
NCBI Official Synonym Full Names
chloride intracellular channel 3
NCBI Official Symbol
CLIC3
NCBI Protein Information
chloride intracellular channel protein 3
UniProt Protein Name
Chloride intracellular channel protein 3
Protein Family
UniProt Gene Name
CLIC3
UniProt Entry Name
CLIC3_HUMAN
Uniprot Description
CLIC3: Can insert into membranes and form chloride ion channels. May participate in cellular growth control. Belongs to the chloride channel CLIC family.
Protein type: Membrane protein, integral; Channel, chloride
Chromosomal Location of Human Ortholog: 9q34.3
Cellular Component: cytoplasm; nucleus
Molecular Function: protein binding; chloride channel activity; voltage-gated ion channel activity
Biological Process: chloride transport; signal transduction
Similar Products
Product Notes
The CLIC3 clic3 (Catalog #AAA6177149) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CLIC3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CLIC3 clic3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CLIC3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
