Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit is 0.3ng/ml using MBS6007561 as a capture antibody.)

Mouse anti-Human CECR1 Monoclonal Antibody | anti-CECR1 antibody

CECR1 (Adenosine Deaminase CECR1, Cat Eye Syndrome Critical Region Protein 1, ADA2, ADGF, IDGFL) (Biotin)

Gene Names
ADA2; PAN; ADGF; CECR1; IDGFL; SNEDS; VAIHS
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
CECR1; Monoclonal Antibody; CECR1 (Adenosine Deaminase CECR1; Cat Eye Syndrome Critical Region Protein 1; ADA2; ADGF; IDGFL) (Biotin); anti-CECR1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D11
Specificity
Recognizes human CECR1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CECR1 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa402-511 from human CECR1 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DIPIEVCPISNQVLKLVSDLRNHPVATLMATGHPMVISSDDPAMFGAKGLSYDFYEVFMGIGGMKADLRTLKQLAMNSIKYSTLLESEKNTFMEIWKKRWDKFIADVATK
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit is 0.3ng/ml using MBS6007561 as a capture antibody.)

Testing Data (Detection limit is 0.3ng/ml using MBS6007561 as a capture antibody.)

Immunoprecipitation (IP)

(Immunoprecipitation of CECR1 transfected lysate using MBS6007561 and Protein A Magnetic Bead and immunoblotted with CECR1 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of CECR1 transfected lysate using MBS6007561 and Protein A Magnetic Bead and immunoblotted with CECR1 rabbit polyclonal antibody.)

Western Blot (WB)

(Western Blot detection against immunogen using MBS6007561 (38.21kD).)

Western Blot (WB) (Western Blot detection against immunogen using MBS6007561 (38.21kD).)
Related Product Information for anti-CECR1 antibody
Adenosine deaminase that may contribute to the degradation of extracellular adenosine, a signaling molecule that controls a variety of cellular responses. Requires elevated adenosine levels for optimal enzyme activity. Binds to cell surfaces via proteoglycans and may play a role in the regulation of cell proliferation and differentiation, independently of its enzyme activity.
Product Categories/Family for anti-CECR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,668 Da
NCBI Official Synonym Full Names
adenosine deaminase 2
NCBI Official Symbol
ADA2
NCBI Official Synonym Symbols
PAN; ADGF; CECR1; IDGFL; SNEDS; VAIHS
NCBI Protein Information
adenosine deaminase 2
UniProt Protein Name
Adenosine deaminase CECR1
Protein Family
UniProt Gene Name
CECR1
UniProt Synonym Gene Names
ADA2; ADGF; IDGFL
UniProt Entry Name
CECR1_HUMAN

NCBI Description

This gene encodes a member of a subfamily of the adenosine deaminase protein family. The encoded protein is one of two adenosine deaminases found in humans, which regulate levels of the signaling molecule, adenosine. The encoded protein is secreted from monocytes undergoing differentiation and may regulate cell proliferation and differentiation. This gene may be responsible for some of the phenotypic features associated with cat eye syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]

Research Articles on CECR1

Similar Products

Product Notes

The CECR1 cecr1 (Catalog #AAA6141144) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CECR1 (Adenosine Deaminase CECR1, Cat Eye Syndrome Critical Region Protein 1, ADA2, ADGF, IDGFL) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CECR1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CECR1 cecr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CECR1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.