Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (FAM50A monoclonal antibody Western Blot analysis of FAM50A expression in PC-12.)

Mouse anti-Human, Rat FAM50A Monoclonal Antibody | anti-FAM50A antibody

FAM50A (Protein FAM50A, Protein HXC-26, Protein XAP-5, DXS9928E, HXC26, XAP5, DXS9928E) APC

Gene Names
FAM50A; 9F; XAP5; HXC26; HXC-26; DXS9928E
Reactivity
Human, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FAM50A; Monoclonal Antibody; FAM50A (Protein FAM50A; Protein HXC-26; Protein XAP-5; DXS9928E; HXC26; XAP5; DXS9928E) APC; anti-FAM50A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5F10
Specificity
Recognizes human FAM50A. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-FAM50A antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 0.5ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-89 from FAM50A (NP_004690) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAQYKGAASEAGRAMHLMKKREKQREQMEQMKQRIAEENIMKSNIDKKFSAHYDAVEAELKSSTVGLVTLNDMKAKQEALVKEREKQL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(FAM50A monoclonal antibody Western Blot analysis of FAM50A expression in PC-12.)

Western Blot (WB) (FAM50A monoclonal antibody Western Blot analysis of FAM50A expression in PC-12.)

Western Blot (WB)

(FAM50A monoclonal antibody Western Blot analysis of FAM50A expression in Hela NE.)

Western Blot (WB) (FAM50A monoclonal antibody Western Blot analysis of FAM50A expression in Hela NE.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to FAM50A on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 0.5ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to FAM50A on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 0.5ug/ml])

Testing Data

(Detection limit for recombinant GST tagged FAM50A is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FAM50A is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-FAM50A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25.2kDa (213aa), confirmed by MALDI-TOF
NCBI Official Full Name
protein FAM50A
NCBI Official Synonym Full Names
family with sequence similarity 50 member A
NCBI Official Symbol
FAM50A
NCBI Official Synonym Symbols
9F; XAP5; HXC26; HXC-26; DXS9928E
NCBI Protein Information
protein FAM50A
UniProt Protein Name
Protein FAM50A
Protein Family
UniProt Gene Name
FAM50A
UniProt Synonym Gene Names
DXS9928E; HXC26; XAP5
UniProt Entry Name
FA50A_HUMAN

NCBI Description

This gene belongs to the FAM50 family. The encoded protein is highly conserved in length and sequence across different species. It is a basic protein containing a nuclear localization signal, and may function as a DNA-binding protein or a transcriptional factor. [provided by RefSeq, Sep 2009]

Uniprot Description

FAM50A: May be a DNA-binding protein or transcriptional factor. Belongs to the FAM50 family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: nucleoplasm; nucleus

Biological Process: spermatogenesis

Research Articles on FAM50A

Similar Products

Product Notes

The FAM50A fam50a (Catalog #AAA6136532) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FAM50A (Protein FAM50A, Protein HXC-26, Protein XAP-5, DXS9928E, HXC26, XAP5, DXS9928E) APC reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FAM50A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 0.5ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FAM50A fam50a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FAM50A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.