Mouse anti-Human, Rat FAM50A Monoclonal Antibody | anti-FAM50A antibody

FAM50A (Protein FAM50A, Protein HXC-26, Protein XAP-5, DXS9928E, HXC26, XAP5, DXS9928E) (HRP)

Cat. Num. AAA6152441

• Gene Names: FAM50A; 9F; XAP5; HXC26; HXC-26; DXS9928E
• Reactivity: Human, Rat
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: FAM50A; Monoclonal Antibody; FAM50A (Protein FAM50A; Protein HXC-26; Protein XAP-5; DXS9928E; HXC26; XAP5; DXS9928E) (HRP); anti-FAM50A antibody

• Host: Mouse
• Reactivity: Human, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 5F10
• Specificity: Recognizes human FAM50A. Species Crossreactivity: rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-FAM50A antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 0.5ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-89 from FAM50A (NP_004690) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAQYKGAASEAGRAMHLMKKREKQREQMEQMKQRIAEENIMKSNIDKKFSAHYDAVEAELKSSTVGLVTLNDMKAKQEALVKEREKQL
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(FAM50A monoclonal antibody Western Blot analysis of FAM50A expression in PC-12.)

Western Blot (WB)

(FAM50A monoclonal antibody Western Blot analysis of FAM50A expression in Hela NE.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to FAM50A on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 0.5ug/ml])

Testing Data

(Detection limit for recombinant GST tagged FAM50A is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-FAM50A antibody

Antibodies; FAM

NCBI and Uniprot Product Information

• NCBI GI #: 4758220
• NCBI GeneID: 9130
• NCBI Accession #: NP_004690
• NCBI GenBank Nucleotide #: NM_004699
• UniProt Accession #: Q14320; Q5HY37; Q6PJH5; A8KAQ4; B2R997
• Molecular Weight: 25.2kDa (213aa), confirmed by MALDI-TOF
• NCBI Official Full Name: protein FAM50A
• NCBI Official Synonym Full Names: family with sequence similarity 50 member A
• NCBI Official Symbol: FAM50A
• NCBI Official Synonym Symbols: 9F; XAP5; HXC26; HXC-26; DXS9928E
• NCBI Protein Information: protein FAM50A
• UniProt Protein Name: Protein FAM50A
• Protein Family: Protein
• UniProt Gene Name: FAM50A
• UniProt Synonym Gene Names: DXS9928E; HXC26; XAP5
• UniProt Entry Name: FA50A_HUMAN

NCBI Description

This gene belongs to the FAM50 family. The encoded protein is highly conserved in length and sequence across different species. It is a basic protein containing a nuclear localization signal, and may function as a DNA-binding protein or a transcriptional factor. [provided by RefSeq, Sep 2009]

Uniprot Description

FAM50A: May be a DNA-binding protein or transcriptional factor. Belongs to the FAM50 family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: nucleoplasm; nucleus

Biological Process: spermatogenesis