Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human Interferon Gamma Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 17 kDa.)

Interferon Gamma Recombinant Protein | IFG recombinant protein

Recombinant Human Interferon Gamma Protein

Gene Names
IFNG; IFG; IFI
Purity
>95% by SDS-PAGE.
Synonyms
Interferon Gamma; Recombinant Human Interferon Gamma Protein; IFI; IFN gamma; IFG recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Sequence Length
166
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
No tag
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human Interferon Gamma Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 17 kDa.)

SDS-Page (Recombinant Human Interferon Gamma Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 17 kDa.)
Related Product Information for IFG recombinant protein
Description: Recombinant Human Interferon Gamma Protein is produced by E. coli expression system. The target protein is expressed with sequence (Gln24-Gln166) of human Interferon Gamma (Accession #NP_000610.2).

Background: Interferon-gamma (IFN-gamma) is a secreted protein which belongs to the type II interferon family.Recombinant Human IFN-gamma is a 16.8 kDa protein containing 143 amino acid residues. IFN-gamma is produced by a variety of immune cells under inflammatory conditions, notably by T cells and NK cells. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. Interferon-gamma is a central regulator of the immune response and signals via the Janus Activated Kinase (JAK)-Signal Transducer and Activator of Transcription (STAT) pathway.
Product Categories/Family for IFG recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interferon gamma
NCBI Official Synonym Full Names
interferon gamma
NCBI Official Symbol
IFNG
NCBI Official Synonym Symbols
IFG; IFI
NCBI Protein Information
interferon gamma
UniProt Protein Name
Interferon gamma
Protein Family
UniProt Gene Name
IFNG
UniProt Synonym Gene Names
IFN-gamma
UniProt Entry Name
IFNG_HUMAN

NCBI Description

This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mutations in this gene are associated with an increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases. [provided by RefSeq, Dec 2015]

Uniprot Description

IFNG: Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons. Homodimer. Released primarily from activated T lymphocytes. Belongs to the type II (or gamma) interferon family.

Protein type: Cytokine; Secreted; Membrane protein, integral; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 12q14

Cellular Component: extracellular space; extracellular region; external side of plasma membrane

Molecular Function: interferon-gamma receptor binding; cytokine activity

Biological Process: positive regulation of isotype switching to IgG isotypes; positive regulation of nitric oxide biosynthetic process; positive regulation of osteoclast differentiation; negative regulation of smooth muscle cell proliferation; apoptosis; positive regulation of interleukin-23 production; positive regulation of interleukin-12 production; positive regulation of interleukin-6 biosynthetic process; negative regulation of epithelial cell differentiation; negative regulation of transcription from RNA polymerase II promoter; positive regulation of killing of cells of another organism; sensory perception of mechanical stimulus; positive regulation of interleukin-1 beta secretion; positive regulation of membrane protein ectodomain proteolysis; cell surface receptor linked signal transduction; positive regulation of MHC class II biosynthetic process; positive regulation of cell proliferation; positive regulation of mesenchymal cell proliferation; positive regulation of T cell proliferation; cell cycle arrest; defense response to virus; regulation of the force of heart contraction; positive regulation of peptidyl-serine phosphorylation of STAT protein; response to drug; neutrophil chemotaxis; positive regulation of synaptic transmission, cholinergic; adaptive immune response; negative regulation of myelination; CD8-positive, alpha-beta T cell differentiation during immune response; unfolded protein response; response to virus; cytokine and chemokine mediated signaling pathway; positive regulation of tumor necrosis factor production; defense response to protozoan; humoral immune response; antigen processing and presentation; positive regulation of tyrosine phosphorylation of Stat1 protein; positive regulation of chemokine biosynthetic process; positive regulation of interleukin-12 biosynthetic process; negative regulation of interleukin-17 production; protein import into nucleus, translocation; defense response to bacterium; neutrophil apoptosis; positive regulation of transcription from RNA polymerase II promoter; positive regulation of neuron differentiation; cell motility; regulation of insulin secretion

Disease: Hepatitis C Virus, Susceptibility To; Aplastic Anemia; Mycobacterium Tuberculosis, Susceptibility To; Tuberous Sclerosis 2; Human Immunodeficiency Virus Type 1, Susceptibility To

Research Articles on IFG

Similar Products

Product Notes

The IFG ifng (Catalog #AAA9141873) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: QDPYVKEAEN LKKYFNAGHS DVADNGTLFL GILKNWKEES DRKIMQSQIV SFYFKLFKNF KDDQSIQKSV ETIKEDMNVK FFNSNKKKRD DFEKLTNYSV TDLNVQRKAI HELIQVMAEL SPAAKTGKRK RSQMLFRGRR ASQ. It is sometimes possible for the material contained within the vial of "Interferon Gamma, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.