Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (33.26kD).)

Mouse anti-Human CCL4L1 Monoclonal Antibody | anti-CCL4L1 antibody

CCL4L1 (C-C Motif Chemokine 4-like, Small-inducible Cytokine A4-like, Monocyte Adherence-induced Protein 5-alpha, Macrophage Inflammatory Protein 1-beta, MIP-1-beta, Lymphocyte Activation Gene 1 Protein, LAG-1, CCL4L, LAG1, SCYA4L1, CCL4L2, CCL4L, SCYA4L2

Gene Names
CCL4L1; LAG1; CCL4L; LAG-1; SCYA4L; AT744.2; SCYA4L1; SCYA4L2; MIP-1-beta
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CCL4L1; Monoclonal Antibody; CCL4L1 (C-C Motif Chemokine 4-like; Small-inducible Cytokine A4-like; Monocyte Adherence-induced Protein 5-alpha; Macrophage Inflammatory Protein 1-beta; MIP-1-beta; Lymphocyte Activation Gene 1 Protein; LAG-1; CCL4L; LAG1; SCYA4L1; CCL4L2; SCYA4L2; anti-CCL4L1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G8
Specificity
Recognizes human CCL4L2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
92
Applicable Applications for anti-CCL4L1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa28-93 from human CCL4L2 (NP_996890) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.26kD).)

Western Blot (WB) (Western Blot detection against Immunogen (33.26kD).)
Related Product Information for anti-CCL4L1 antibody
CCL4L1 is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. This protein is similar to CCL4 which inhibits HIV entry by binding to the cellular receptor CCR5. The copy number of this gene varies among individuals; most individuals have 1-5 copies in the diploid genome, although rare individuals do not contain this gene at all. The human genome reference assembly contains two copies of this gene. This record represents the more centromeric gene.
Product Categories/Family for anti-CCL4L1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
C-C motif chemokine 4-like
NCBI Official Synonym Full Names
C-C motif chemokine ligand 4 like 1
NCBI Official Symbol
CCL4L1
NCBI Official Synonym Symbols
LAG1; CCL4L; LAG-1; SCYA4L; AT744.2; SCYA4L1; SCYA4L2; MIP-1-beta
NCBI Protein Information
C-C motif chemokine 4-like
Protein Family

NCBI Description

This gene is one of several cytokine genes that are clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins that function in inflammatory and immunoregulatory processes. The protein encoded by this family member is similar to the chemokine (C-C motif) ligand 4 product, which inhibits HIV entry by binding to the cellular receptor CCR5. The copy number of this gene varies among individuals, where most individuals have one to five copies. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Apr 2014]

Research Articles on CCL4L1

Similar Products

Product Notes

The CCL4L1 (Catalog #AAA6135706) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CCL4L1 (C-C Motif Chemokine 4-like, Small-inducible Cytokine A4-like, Monocyte Adherence-induced Protein 5-alpha, Macrophage Inflammatory Protein 1-beta, MIP-1-beta, Lymphocyte Activation Gene 1 Protein, LAG-1, CCL4L, LAG1, SCYA4L1, CCL4L2, CCL4L, SCYA4L2 reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CCL4L1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CCL4L1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CCL4L1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.