Mouse CNR1 Monoclonal Antibody | anti-CNR1 antibody

CNR1 (Cannabinoid Receptor 1 (Brain), CANN6, CB-R, CB1, CB1A, CB1K5, CB1R, CNR) (HRP)

Cat. Num. AAA6181502

• Gene Names: CNR1; CB1; CNR; CB-R; CB1A; CB1R; CANN6; CB1K5
• Applications: Western Blot
• Purity: Purified
• Synonyms: CNR1; Monoclonal Antibody; CNR1 (Cannabinoid Receptor 1 (Brain); CANN6; CB-R; CB1; CB1A; CB1K5; CB1R; CNR) (HRP); Cannabinoid Receptor 1 (Brain); CNR; anti-CNR1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1F9
• Specificity: Recognizes CNR1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-CNR1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: CNR1 (NP_057167, 1aa-110aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMV
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CNR1 is approximately 0.1ng/ml as a capture antibody.)

Western Blot (WB)

(CNR1 monoclonal antibody (M02), clone 1F9. Western Blot analysis of CNR1 expression in rat testis.)

Product Categories/Family for anti-CNR1 antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 38683844
• NCBI GeneID: 1268
• NCBI Accession #: NP_057167
• NCBI GenBank Nucleotide #: NM_016083
• UniProt Accession #: P21554
• Molecular Weight: 45kDa
• NCBI Official Full Name: cannabinoid receptor 1 isoform a
• NCBI Official Synonym Full Names: cannabinoid receptor 1
• NCBI Official Symbol: CNR1
• NCBI Official Synonym Symbols: CB1; CNR; CB-R; CB1A; CB1R; CANN6; CB1K5
• NCBI Protein Information: cannabinoid receptor 1
• UniProt Protein Name: Cannabinoid receptor 1
• Protein Family: Cannabinoid receptor
• UniProt Gene Name: CNR1
• UniProt Synonym Gene Names: CNR; CB-R; CB1
• UniProt Entry Name: CNR1_HUMAN

NCBI Description

This gene encodes one of two cannabinoid receptors. The cannabinoids, principally delta-9-tetrahydrocannabinol and synthetic analogs, are psychoactive ingredients of marijuana. The cannabinoid receptors are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family, which inhibit adenylate cyclase activity in a dose-dependent, stereoselective and pertussis toxin-sensitive manner. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. Multiple transcript variants encoding two different protein isoforms have been described for this gene. [provided by RefSeq, May 2009]

Uniprot Description

CNR1: Involved in cannabinoid-induced CNS effects. Acts by inhibiting adenylate cyclase. Could be a receptor for anandamide. Inhibits L-type Ca(2+) channel current. Isoform 2 and isoform 3 have altered ligand binding. Belongs to the G-protein coupled receptor 1 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, GPCR; GPCR, family 1; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 6q14-q15

Cellular Component: growth cone; intracellular membrane-bound organelle; integral to plasma membrane; axon; plasma membrane

Molecular Function: cannabinoid receptor activity; drug binding

Biological Process: response to nicotine; maternal process involved in pregnancy; negative regulation of fatty acid beta-oxidation; regulation of synaptic transmission, glutamatergic; positive regulation of apoptosis; response to morphine; positive regulation of acute inflammatory response to antigenic stimulus; response to lipopolysaccharide; sensory perception of pain; glucose homeostasis; negative regulation of blood pressure; negative regulation of dopamine secretion; response to nutrient; aging; negative regulation of mast cell activation; negative regulation of nitric-oxide synthase activity; axonal fasciculation; negative regulation of action potential; response to cocaine; regulation of synaptic transmission, GABAergic; memory; G-protein signaling, coupled to cAMP nucleotide second messenger; G-protein signaling, coupled to cyclic nucleotide second messenger; response to ethanol; positive regulation of fever; spermatogenesis; regulation of insulin secretion; positive regulation of blood pressure