Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human MAP3K13 Monoclonal Antibody | anti-MAP3K13 antibody

MAP3K13 (LZK, Mitogen-activated Protein Kinase Kinase Kinase 13, Leucine Zipper-bearing Kinase, Mixed Lineage Kinase) (AP)

Gene Names
MAP3K13; LZK; MLK; MEKK13
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MAP3K13; Monoclonal Antibody; MAP3K13 (LZK; Mitogen-activated Protein Kinase Kinase Kinase 13; Leucine Zipper-bearing Kinase; Mixed Lineage Kinase) (AP); anti-MAP3K13 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4H7
Specificity
Recognizes human MAP3K13.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-MAP3K13 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa711-810 from MAP3K13 (NP_004712) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SEPDKGQAGPWGCCQADAYDPCLQCRPEQYGSLDIPSAEPVGRSPDLSKSPAHNPLLENAQSSEKTEENEFSGCRSESSLGTSHLGTPPALPRKTRPLQK
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(MAP3K13 monoclonal antibody Western Blot analysis of MAP3K13 expression in K-562.)

Western Blot (WB) (MAP3K13 monoclonal antibody Western Blot analysis of MAP3K13 expression in K-562.)
Product Categories/Family for anti-MAP3K13 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
966
NCBI Official Full Name
mitogen-activated protein kinase kinase kinase 13 isoform 1
NCBI Official Synonym Full Names
mitogen-activated protein kinase kinase kinase 13
NCBI Official Symbol
MAP3K13
NCBI Official Synonym Symbols
LZK; MLK; MEKK13
NCBI Protein Information
mitogen-activated protein kinase kinase kinase 13
UniProt Protein Name
Mitogen-activated protein kinase kinase kinase 13
UniProt Gene Name
MAP3K13
UniProt Synonym Gene Names
LZK; MLK
UniProt Entry Name
M3K13_HUMAN

NCBI Description

The protein encoded by this gene is a member of serine/threonine protein kinase family. This kinase contains a dual leucine-zipper motif, and has been shown to form dimers/oligomers through its leucine-zipper motif. This kinase can phosphorylate and activate MAPK8/JNK, MAP2K7/MKK7, which suggests a role in the JNK signaling pathway. [provided by RefSeq, Jul 2008]

Uniprot Description

LZK: a TKL kinase of the MLK family. Synergizes with antioxidant protein-1 to activate NF-kappaB. Forms a functional signaling complex with JIP-1, a scaffold protein of the c-Jun NH(2)-terminal kinase pathway. This kinase can phosphorylate and activate JNK and MKK7. Contains a dual leucine-zipper motif, and has been shown to form dimers/oligomers through its leucine-zipper motif.

Protein type: Protein kinase, Ser/Thr (non-receptor); Protein kinase, TKL; EC 2.7.11.25; Kinase, protein; TKL group; MLK family; LZK subfamily

Chromosomal Location of Human Ortholog: 3q27

Cellular Component: membrane; IkappaB kinase complex

Molecular Function: identical protein binding; protein serine/threonine kinase activity; protein binding; protein homodimerization activity; MAP kinase kinase kinase activity; metal ion binding; protein kinase binding; ATP binding

Biological Process: activation of MAPKK activity; protein amino acid autophosphorylation; JNK cascade; protein amino acid phosphorylation; activation of NF-kappaB transcription factor

Research Articles on MAP3K13

Similar Products

Product Notes

The MAP3K13 map3k13 (Catalog #AAA6132200) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MAP3K13 (LZK, Mitogen-activated Protein Kinase Kinase Kinase 13, Leucine Zipper-bearing Kinase, Mixed Lineage Kinase) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAP3K13 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAP3K13 map3k13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAP3K13, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.