Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-HARS2 AntibodyTitration: 1.0 ug/mlPositive Control: PANC1 Whole CellHARS2 is supported by BioGPS gene expression data to be expressed in PANC1)

Rabbit HARS2 Polyclonal Antibody | anti-HARS2 antibody

HARS2 antibody - N-terminal region

Gene Names
HARS2; HO3; HARSL; HARSR; HisRS; PRLTS2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HARS2; Polyclonal Antibody; HARS2 antibody - N-terminal region; anti-HARS2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AWASLLSQLLRPPCASCTGAVRCQSQVAEAVLTSQLKAHQEKPNFIIKTP
Sequence Length
506
Applicable Applications for anti-HARS2 antibody
Western Blot (WB)
Homology
Cow: 83%; Dog: 79%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 87%; Rabbit: 86%; Rat: 80%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HARS2 AntibodyTitration: 1.0 ug/mlPositive Control: PANC1 Whole CellHARS2 is supported by BioGPS gene expression data to be expressed in PANC1)

Western Blot (WB) (WB Suggested Anti-HARS2 AntibodyTitration: 1.0 ug/mlPositive Control: PANC1 Whole CellHARS2 is supported by BioGPS gene expression data to be expressed in PANC1)
Related Product Information for anti-HARS2 antibody
This is a rabbit polyclonal antibody against HARS2. It was validated on Western Blot

Target Description: Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene is an enzyme belonging to the class II family of aminoacyl-tRNA synthetases. Functioning in the synthesis of histidyl-transfer RNA, the enzyme plays an accessory role in the regulation of protein biosynthesis. The gene is located in a head-to-head orientation with HARS on chromosome five, where the homologous genes share a bidirectional promoter.
Product Categories/Family for anti-HARS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
probable histidine--tRNA ligase, mitochondrial isoform 1
NCBI Official Synonym Full Names
histidyl-tRNA synthetase 2, mitochondrial
NCBI Official Symbol
HARS2
NCBI Official Synonym Symbols
HO3; HARSL; HARSR; HisRS; PRLTS2
NCBI Protein Information
probable histidine--tRNA ligase, mitochondrial
UniProt Protein Name
Probable histidine--tRNA ligase, mitochondrial
UniProt Gene Name
HARS2
UniProt Synonym Gene Names
HARSL; HARSR; HO3; HisRS

NCBI Description

Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene is an enzyme belonging to the class II family of aminoacyl-tRNA synthetases. Functioning in the synthesis of histidyl-transfer RNA, the enzyme plays an accessory role in the regulation of protein biosynthesis. The gene is located in a head-to-head orientation with HARS on chromosome five, where the homologous genes likely share a bidirectional promoter. Mutations in this gene are associated with the pathogenesis of Perrault syndrome, which involves ovarian dysgenesis and sensorineural hearing loss. Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jul 2013]

Uniprot Description

HARS2: Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene is an enzyme belonging to the class II family of aminoacyl-tRNA synthetases. Functioning in the synthesis of histidyl-transfer RNA, the enzyme plays an accessory role in the regulation of protein biosynthesis. The gene is located in a head-to-head orientation with HARS on chromosome five, where the homologous genes share a bidirectional promoter. [provided by RefSeq, Jul 2008]

Protein type: Aminoacyl-tRNA synthetase; EC 6.1.1.21; Ligase; Mitochondrial; Translation; Translation regulation

Chromosomal Location of Human Ortholog: 5q31.3

Cellular Component: mitochondrial matrix; mitochondrion

Molecular Function: ATP binding; histidine-tRNA ligase activity; protein binding; protein homodimerization activity; RNA binding

Biological Process: histidyl-tRNA aminoacylation; mitochondrial translation; translation; tRNA aminoacylation for protein translation

Disease: Perrault Syndrome 2

Research Articles on HARS2

Similar Products

Product Notes

The HARS2 hars2 (Catalog #AAA3215694) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HARS2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HARS2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HARS2 hars2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AWASLLSQLL RPPCASCTGA VRCQSQVAEA VLTSQLKAHQ EKPNFIIKTP. It is sometimes possible for the material contained within the vial of "HARS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.