Mouse anti-Human MAP3K13 Monoclonal Antibody | anti-MAP3K13 antibody

MAP3K13 (LZK, Mitogen-activated Protein Kinase Kinase Kinase 13, Leucine Zipper-bearing Kinase, Mixed Lineage Kinase) APC

Cat. Num. AAA6137503

• Gene Names: MAP3K13; LZK; MLK; MEKK13
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MAP3K13; Monoclonal Antibody; MAP3K13 (LZK; Mitogen-activated Protein Kinase Kinase Kinase 13; Leucine Zipper-bearing Kinase; Mixed Lineage Kinase) APC; anti-MAP3K13 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4H7
• Specificity: Recognizes human MAP3K13.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-MAP3K13 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa711-810 from MAP3K13 (NP_004712) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SEPDKGQAGPWGCCQADAYDPCLQCRPEQYGSLDIPSAEPVGRSPDLSKSPAHNPLLENAQSSEKTEENEFSGCRSESSLGTSHLGTPPALPRKTRPLQK
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(MAP3K13 monoclonal antibody Western Blot analysis of MAP3K13 expression in K-562.)

Product Categories/Family for anti-MAP3K13 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 4758696
• NCBI GeneID: 9175
• NCBI Accession #: NP_004712
• NCBI GenBank Nucleotide #: NM_004721
• UniProt Accession #: O43283
• Molecular Weight: 966
• NCBI Official Full Name: mitogen-activated protein kinase kinase kinase 13 isoform 1
• NCBI Official Synonym Full Names: mitogen-activated protein kinase kinase kinase 13
• NCBI Official Symbol: MAP3K13
• NCBI Official Synonym Symbols: LZK; MLK; MEKK13
• NCBI Protein Information: mitogen-activated protein kinase kinase kinase 13
• UniProt Protein Name: Mitogen-activated protein kinase kinase kinase 13
• Protein Family: Mitogen-activated protein kinase kinase kinase
• UniProt Gene Name: MAP3K13
• UniProt Synonym Gene Names: LZK; MLK
• UniProt Entry Name: M3K13_HUMAN

NCBI Description

The protein encoded by this gene is a member of serine/threonine protein kinase family. This kinase contains a dual leucine-zipper motif, and has been shown to form dimers/oligomers through its leucine-zipper motif. This kinase can phosphorylate and activate MAPK8/JNK, MAP2K7/MKK7, which suggests a role in the JNK signaling pathway. [provided by RefSeq, Jul 2008]

Uniprot Description

LZK: a TKL kinase of the MLK family. Synergizes with antioxidant protein-1 to activate NF-kappaB. Forms a functional signaling complex with JIP-1, a scaffold protein of the c-Jun NH(2)-terminal kinase pathway. This kinase can phosphorylate and activate JNK and MKK7. Contains a dual leucine-zipper motif, and has been shown to form dimers/oligomers through its leucine-zipper motif.

Protein type: Protein kinase, Ser/Thr (non-receptor); Protein kinase, TKL; EC 2.7.11.25; Kinase, protein; TKL group; MLK family; LZK subfamily

Chromosomal Location of Human Ortholog: 3q27

Cellular Component: membrane; IkappaB kinase complex

Molecular Function: identical protein binding; protein serine/threonine kinase activity; protein binding; protein homodimerization activity; MAP kinase kinase kinase activity; metal ion binding; protein kinase binding; ATP binding

Biological Process: activation of MAPKK activity; protein amino acid autophosphorylation; JNK cascade; protein amino acid phosphorylation; activation of NF-kappaB transcription factor